data_2KQ7 # _entry.id 2KQ7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KQ7 pdb_00002kq7 10.2210/pdb2kq7/pdb RCSB RCSB101436 ? ? WWPDB D_1000101436 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16120 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KQ7 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-10-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Schwarten, M.' 1 'Stoldt, M.' 2 'Mohrluder, J.' 3 'Willbold, D.' 4 # _citation.id primary _citation.title 'Solution structure of Atg8 reveals conformational polymorphism of the N-terminal domain' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2010 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 1090-2104 _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20382112 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2010.04.043 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schwarten, M.' 1 ? primary 'Stoldt, M.' 2 ? primary 'Mohrluder, J.' 3 ? primary 'Willbold, D.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Autophagy-related protein 8' _entity.formula_weight 13792.940 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Autophagy-related ubiquitin-like modifier ATG8, Cytoplasm to vacuole targeting protein 5' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFI FVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFI FVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 LYS n 1 5 SER n 1 6 THR n 1 7 PHE n 1 8 LYS n 1 9 SER n 1 10 GLU n 1 11 TYR n 1 12 PRO n 1 13 PHE n 1 14 GLU n 1 15 LYS n 1 16 ARG n 1 17 LYS n 1 18 ALA n 1 19 GLU n 1 20 SER n 1 21 GLU n 1 22 ARG n 1 23 ILE n 1 24 ALA n 1 25 ASP n 1 26 ARG n 1 27 PHE n 1 28 LYS n 1 29 ASN n 1 30 ARG n 1 31 ILE n 1 32 PRO n 1 33 VAL n 1 34 ILE n 1 35 CYS n 1 36 GLU n 1 37 LYS n 1 38 ALA n 1 39 GLU n 1 40 LYS n 1 41 SER n 1 42 ASP n 1 43 ILE n 1 44 PRO n 1 45 GLU n 1 46 ILE n 1 47 ASP n 1 48 LYS n 1 49 ARG n 1 50 LYS n 1 51 TYR n 1 52 LEU n 1 53 VAL n 1 54 PRO n 1 55 ALA n 1 56 ASP n 1 57 LEU n 1 58 THR n 1 59 VAL n 1 60 GLY n 1 61 GLN n 1 62 PHE n 1 63 VAL n 1 64 TYR n 1 65 VAL n 1 66 ILE n 1 67 ARG n 1 68 LYS n 1 69 ARG n 1 70 ILE n 1 71 MET n 1 72 LEU n 1 73 PRO n 1 74 PRO n 1 75 GLU n 1 76 LYS n 1 77 ALA n 1 78 ILE n 1 79 PHE n 1 80 ILE n 1 81 PHE n 1 82 VAL n 1 83 ASN n 1 84 ASP n 1 85 THR n 1 86 LEU n 1 87 PRO n 1 88 PRO n 1 89 THR n 1 90 ALA n 1 91 ALA n 1 92 LEU n 1 93 MET n 1 94 SER n 1 95 ALA n 1 96 ILE n 1 97 TYR n 1 98 GLN n 1 99 GLU n 1 100 HIS n 1 101 LYS n 1 102 ASP n 1 103 LYS n 1 104 ASP n 1 105 GLY n 1 106 PHE n 1 107 LEU n 1 108 TYR n 1 109 VAL n 1 110 THR n 1 111 TYR n 1 112 SER n 1 113 GLY n 1 114 GLU n 1 115 ASN n 1 116 THR n 1 117 PHE n 1 118 GLY n 1 119 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ATG8 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3 Rosetta' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pGex-4T-2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ATG8_YEAST _struct_ref.pdbx_db_accession P38182 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFV NDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KQ7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P38182 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 117 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KQ7 GLY A 1 ? UNP P38182 ? ? 'expression tag' 1 1 1 2KQ7 SER A 2 ? UNP P38182 ? ? 'expression tag' 2 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HNHA' 1 7 1 '3D HCCH-COSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 2 '1D 1H' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20mM sodium phosphate-1, 150mM sodium chloride-2, 5mM DTT-3, 1mM EDTA-4, 0.05% sodium azide-5, 0.5mM [U-13C; U-15N] Atg8-6, 93% H2O/7% D2O ; 1 '93% H2O/7% D2O' ;20mM sodium phosphate-7, 150mM sodium chloride-8, 5mM DTT-9, 1mM EDTA-10, 0.05% sodium azide-11, 0.5mM [U-13C; U-15N] Atg8-12, 1mM DSS-13, 93% H2O/7% D2O ; 2 '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian VNMRS 1 'Varian VNMRS' 600 Varian Unity_INOVA 2 'Varian Unity_INOVA' # _pdbx_nmr_refine.entry_id 2KQ7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KQ7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KQ7 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VnmrJ ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Keller 'chemical shift assignment' CARA ? 3 'Guntert, Braun and Wuthrich' 'structure solution' CYANA ? 4 'Guntert, Braun and Wuthrich' refinement CYANA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KQ7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KQ7 _struct.title 'Solution structure of the Autophagy-Related Protein Atg8' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KQ7 _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' _struct_keywords.text ;Protein Transport, Autophagy, ubiquitin fold, Cytoplasmic vesicle, Lipoprotein, Membrane, Transport, Ubl conjugation pathway, Vacuole ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 17 ? PHE A 27 ? LYS A 17 PHE A 27 1 ? 11 HELX_P HELX_P2 2 THR A 58 ? ILE A 70 ? THR A 58 ILE A 70 1 ? 13 HELX_P HELX_P3 3 LEU A 92 ? HIS A 100 ? LEU A 92 HIS A 100 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 51 ? PRO A 54 ? TYR A 51 PRO A 54 A 2 ARG A 30 ? LYS A 37 ? ARG A 30 LYS A 37 A 3 LEU A 107 ? SER A 112 ? LEU A 107 SER A 112 A 4 PHE A 79 ? PHE A 81 ? PHE A 79 PHE A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 53 ? O VAL A 53 N ILE A 31 ? N ILE A 31 A 2 3 N GLU A 36 ? N GLU A 36 O VAL A 109 ? O VAL A 109 A 3 4 O THR A 110 ? O THR A 110 N PHE A 81 ? N PHE A 81 # _atom_sites.entry_id 2KQ7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 MET 93 93 93 MET MET A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 PHE 106 106 106 PHE PHE A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 TYR 111 111 111 TYR TYR A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 ARG 119 119 119 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-05-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 150 ? mM ? 1 DTT-3 5 ? mM ? 1 EDTA-4 1 ? mM ? 1 'sodium azide-5' 0.05 ? % ? 1 Atg8-6 0.5 ? mM '[U-13C; U-15N]' 1 'sodium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 150 ? mM ? 2 DTT-9 5 ? mM ? 2 EDTA-10 1 ? mM ? 2 'sodium azide-11' 0.05 ? % ? 2 Atg8-12 0.5 ? mM '[U-13C; U-15N]' 2 DSS-13 1 ? mM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -55.05 172.48 2 1 PRO A 32 ? ? -69.83 85.45 3 1 LYS A 40 ? ? -96.58 43.31 4 1 LEU A 52 ? ? -64.62 92.10 5 1 ASP A 102 ? ? -49.44 156.56 6 1 PHE A 106 ? ? -179.94 127.83 7 2 PRO A 12 ? ? -69.70 81.01 8 2 LYS A 15 ? ? -56.98 106.00 9 2 LYS A 28 ? ? -87.63 -75.35 10 2 PRO A 32 ? ? -69.76 91.92 11 2 LYS A 40 ? ? -91.69 50.96 12 2 ARG A 49 ? ? -84.73 -74.18 13 2 PHE A 117 ? ? -125.62 -57.29 14 3 TYR A 11 ? ? -117.66 72.74 15 3 PRO A 32 ? ? -69.73 93.61 16 4 PRO A 32 ? ? -69.73 85.97 17 4 ARG A 49 ? ? -76.67 -74.59 18 4 LEU A 52 ? ? -68.39 91.94 19 4 PHE A 106 ? ? -172.03 116.49 20 4 PHE A 117 ? ? -49.86 168.10 21 5 TYR A 11 ? ? 52.28 71.91 22 5 PRO A 32 ? ? -69.77 85.97 23 5 ASP A 47 ? ? -67.62 85.30 24 5 LEU A 52 ? ? -64.69 91.51 25 5 PHE A 106 ? ? -177.85 122.64 26 6 SER A 2 ? ? -58.09 177.05 27 6 PRO A 12 ? ? -69.85 -175.04 28 6 LYS A 28 ? ? -66.47 -71.51 29 6 PRO A 32 ? ? -69.75 91.55 30 6 LYS A 48 ? ? 65.59 79.89 31 6 ALA A 91 ? ? -67.24 -169.74 32 6 PHE A 106 ? ? -98.87 -76.94 33 7 TYR A 11 ? ? 59.24 71.98 34 7 PRO A 12 ? ? -69.82 93.33 35 7 PRO A 32 ? ? -69.78 89.31 36 7 LYS A 40 ? ? -102.37 65.03 37 7 ARG A 49 ? ? -101.66 -74.67 38 7 LEU A 52 ? ? -67.42 91.18 39 7 ASP A 102 ? ? -52.25 170.22 40 7 ASP A 104 ? ? -91.93 34.98 41 8 ASN A 29 ? ? 52.28 79.64 42 8 PRO A 32 ? ? -69.77 92.13 43 8 LYS A 40 ? ? -105.01 56.28 44 8 GLU A 45 ? ? -57.69 -178.96 45 8 PHE A 106 ? ? -56.61 -176.80 46 9 TYR A 11 ? ? -116.05 73.39 47 9 ASN A 29 ? ? -95.61 33.66 48 9 PRO A 32 ? ? -69.77 89.02 49 9 ALA A 91 ? ? -61.38 -169.49 50 10 MET A 3 ? ? -59.22 177.68 51 10 TYR A 11 ? ? 54.55 70.54 52 10 ARG A 16 ? ? -93.91 -68.51 53 10 PRO A 32 ? ? -69.71 89.07 54 10 ALA A 38 ? ? -56.38 175.81 55 10 ASP A 47 ? ? -94.63 36.53 56 10 ALA A 91 ? ? -61.61 -176.26 57 10 ASP A 102 ? ? -49.96 167.56 58 10 PHE A 106 ? ? -179.29 134.17 59 11 PHE A 13 ? ? -92.79 -60.12 60 11 PRO A 32 ? ? -69.71 91.28 61 11 LYS A 48 ? ? 62.86 106.83 62 11 ARG A 49 ? ? -178.40 -169.16 63 11 LEU A 52 ? ? -64.94 91.78 64 11 ALA A 91 ? ? -68.02 -179.33 65 11 ASP A 102 ? ? -49.48 158.88 66 12 PRO A 32 ? ? -69.66 93.36 67 12 ALA A 38 ? ? -54.78 172.48 68 12 SER A 41 ? ? -170.40 149.07 69 12 ASP A 102 ? ? -48.21 164.05 70 13 PRO A 32 ? ? -69.86 90.47 71 13 LYS A 40 ? ? -106.42 58.10 72 13 ASP A 47 ? ? -49.07 -70.14 73 13 ALA A 77 ? ? -116.35 -168.54 74 13 ALA A 91 ? ? -68.47 -171.74 75 13 ASP A 102 ? ? -49.50 166.02 76 14 LYS A 40 ? ? -93.56 41.58 77 14 GLU A 45 ? ? -60.06 -171.22 78 14 ARG A 49 ? ? -128.05 -67.53 79 14 ASP A 102 ? ? -48.01 163.38 80 14 PHE A 106 ? ? -49.54 158.92 81 15 SER A 5 ? ? -177.81 131.64 82 15 PRO A 12 ? ? -69.80 89.37 83 15 PHE A 27 ? ? -96.50 36.67 84 15 PRO A 32 ? ? -69.78 99.62 85 15 ALA A 38 ? ? -51.96 171.25 86 15 GLU A 45 ? ? -56.12 178.97 87 15 ASP A 47 ? ? -94.58 44.90 88 15 ARG A 49 ? ? -112.06 -74.50 89 15 LEU A 52 ? ? -69.20 92.55 #