data_2KR1 # _entry.id 2KR1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KR1 RCSB RCSB101466 BMRB 16620 WWPDB D_1000101466 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16620 BMRB unspecified . HR3662A TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KR1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-11-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Yee, A.' 2 'Fares, C.' 3 'Semesi, A.' 4 'Xiao, R.' 5 'Montelione, G.' 6 'Dhe-Paganon, S.' 7 'Arrowsmith, C.' 8 'Northeast Structural Genomics Consortium (NESG)' 9 'Structural Genomics Consortium (SGC)' 10 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Zn-binding AZUL domain of human ubiquitin protein ligase Ube3A.' J.Biomol.Nmr 51 185 190 2011 JBNME9 NE 0925-2738 0800 ? 21947926 10.1007/s10858-011-9552-y 1 'A novel strategy for NMR resonance assignment and protein structure determination.' J.Biomol.Nmr 49 27 38 2011 JBNME9 NE 0925-2738 0800 ? 21161328 10.1007/s10858-010-9458-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lemak, A.' 1 ? primary 'Yee, A.' 2 ? primary 'Bezsonova, I.' 3 ? primary 'Dhe-Paganon, S.' 4 ? primary 'Arrowsmith, C.H.' 5 ? 1 'Lemak, A.' 6 ? 1 'Gutmanas, A.' 7 ? 1 'Chitayat, S.' 8 ? 1 'Karra, M.' 9 ? 1 'Fares, C.' 10 ? 1 'Sunnerhagen, M.' 11 ? 1 'Arrowsmith, C.H.' 12 ? # _cell.entry_id 2KR1 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KR1 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin protein ligase E3A' 9411.713 1 ? ? 'N-terminal residues 1-64' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;CTCL tumor antigen se37-2, cDNA FLJ77551, Ubiquitin protein ligase E3A isoform CRA_a, Ubiquitin protein ligase E3A isoform CRA_b, Human papilloma virus E6-associated protein, Angelman syndrome ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGRENLYFQGMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDP HP ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGRENLYFQGMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDP HP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR3662A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 ARG n 1 12 GLU n 1 13 ASN n 1 14 LEU n 1 15 TYR n 1 16 PHE n 1 17 GLN n 1 18 GLY n 1 19 MET n 1 20 LYS n 1 21 ARG n 1 22 ALA n 1 23 ALA n 1 24 ALA n 1 25 LYS n 1 26 HIS n 1 27 LEU n 1 28 ILE n 1 29 GLU n 1 30 ARG n 1 31 TYR n 1 32 TYR n 1 33 HIS n 1 34 GLN n 1 35 LEU n 1 36 THR n 1 37 GLU n 1 38 GLY n 1 39 CYS n 1 40 GLY n 1 41 ASN n 1 42 GLU n 1 43 ALA n 1 44 CYS n 1 45 THR n 1 46 ASN n 1 47 GLU n 1 48 PHE n 1 49 CYS n 1 50 ALA n 1 51 SER n 1 52 CYS n 1 53 PRO n 1 54 THR n 1 55 PHE n 1 56 LEU n 1 57 ARG n 1 58 MET n 1 59 ASP n 1 60 ASN n 1 61 ASN n 1 62 ALA n 1 63 ALA n 1 64 ALA n 1 65 ILE n 1 66 LYS n 1 67 ALA n 1 68 LEU n 1 69 GLU n 1 70 LEU n 1 71 TYR n 1 72 LYS n 1 73 ILE n 1 74 ASN n 1 75 ALA n 1 76 LYS n 1 77 LEU n 1 78 CYS n 1 79 ASP n 1 80 PRO n 1 81 HIS n 1 82 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'UBE3A, hCG_18679' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET28-MHL _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9H2G0_HUMAN _struct_ref.pdbx_db_accession Q9H2G0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHP _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KR1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 19 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 82 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9H2G0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 64 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 64 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KR1 MET A 1 ? UNP Q9H2G0 ? ? 'expression tag' -17 1 1 2KR1 HIS A 2 ? UNP Q9H2G0 ? ? 'expression tag' -16 2 1 2KR1 HIS A 3 ? UNP Q9H2G0 ? ? 'expression tag' -15 3 1 2KR1 HIS A 4 ? UNP Q9H2G0 ? ? 'expression tag' -14 4 1 2KR1 HIS A 5 ? UNP Q9H2G0 ? ? 'expression tag' -13 5 1 2KR1 HIS A 6 ? UNP Q9H2G0 ? ? 'expression tag' -12 6 1 2KR1 HIS A 7 ? UNP Q9H2G0 ? ? 'expression tag' -11 7 1 2KR1 SER A 8 ? UNP Q9H2G0 ? ? 'expression tag' -10 8 1 2KR1 SER A 9 ? UNP Q9H2G0 ? ? 'expression tag' -9 9 1 2KR1 GLY A 10 ? UNP Q9H2G0 ? ? 'expression tag' -8 10 1 2KR1 ARG A 11 ? UNP Q9H2G0 ? ? 'expression tag' -7 11 1 2KR1 GLU A 12 ? UNP Q9H2G0 ? ? 'expression tag' -6 12 1 2KR1 ASN A 13 ? UNP Q9H2G0 ? ? 'expression tag' -5 13 1 2KR1 LEU A 14 ? UNP Q9H2G0 ? ? 'expression tag' -4 14 1 2KR1 TYR A 15 ? UNP Q9H2G0 ? ? 'expression tag' -3 15 1 2KR1 PHE A 16 ? UNP Q9H2G0 ? ? 'expression tag' -2 16 1 2KR1 GLN A 17 ? UNP Q9H2G0 ? ? 'expression tag' -1 17 1 2KR1 GLY A 18 ? UNP Q9H2G0 ? ? 'expression tag' 0 18 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D 1H-13C_arom NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] hs00184, 10 mM mops, 450 mM sodium chloride, 10 uM ZnSO4, 10 mM DTT, 0.01 % NaN3, 10 mM benzamidine, 10 % D2O-8, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KR1 _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KR1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KR1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'peak picking' Sparky ? 2 'Lemak, Steren, Llinas, Arrowsmith' 'chemical shift assignment' FMC ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KR1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KR1 _struct.title ;Solution NMR structure of zinc binding N-terminal domain of ubiquitin-protein ligase E3A from Homo Sapiens. Northeast Structural Genomics Consortium (NESG) target HR3662 ; _struct.pdbx_descriptor 'CTCL tumor antigen se37-2' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KR1 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text ;Ligase, Ubl conjugation pathway, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Structural Genomics Consortium (SGC) ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 21 ? GLU A 37 ? ARG A 3 GLU A 19 1 ? 17 HELX_P HELX_P2 2 ASP A 59 ? ASN A 74 ? ASP A 41 ASN A 56 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 26 A CYS 34 1_555 ? ? ? ? ? ? ? 2.966 ? metalc1 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 65 1_555 ? ? ? ? ? ? ? 2.329 ? metalc2 metalc ? ? A CYS 49 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 31 A ZN 65 1_555 ? ? ? ? ? ? ? 2.330 ? metalc3 metalc ? ? A CYS 78 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 60 A ZN 65 1_555 ? ? ? ? ? ? ? 2.341 ? metalc4 metalc ? ? A CYS 44 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 65 1_555 ? ? ? ? ? ? ? 2.371 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 65' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 39 ? CYS A 21 . ? 1_555 ? 2 AC1 4 CYS A 44 ? CYS A 26 . ? 1_555 ? 3 AC1 4 CYS A 49 ? CYS A 31 . ? 1_555 ? 4 AC1 4 CYS A 78 ? CYS A 60 . ? 1_555 ? # _atom_sites.entry_id 2KR1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -17 ? ? ? A . n A 1 2 HIS 2 -16 ? ? ? A . n A 1 3 HIS 3 -15 ? ? ? A . n A 1 4 HIS 4 -14 ? ? ? A . n A 1 5 HIS 5 -13 ? ? ? A . n A 1 6 HIS 6 -12 ? ? ? A . n A 1 7 HIS 7 -11 ? ? ? A . n A 1 8 SER 8 -10 ? ? ? A . n A 1 9 SER 9 -9 ? ? ? A . n A 1 10 GLY 10 -8 ? ? ? A . n A 1 11 ARG 11 -7 ? ? ? A . n A 1 12 GLU 12 -6 ? ? ? A . n A 1 13 ASN 13 -5 ? ? ? A . n A 1 14 LEU 14 -4 ? ? ? A . n A 1 15 TYR 15 -3 ? ? ? A . n A 1 16 PHE 16 -2 ? ? ? A . n A 1 17 GLN 17 -1 ? ? ? A . n A 1 18 GLY 18 0 ? ? ? A . n A 1 19 MET 19 1 1 MET MET A . n A 1 20 LYS 20 2 2 LYS LYS A . n A 1 21 ARG 21 3 3 ARG ARG A . n A 1 22 ALA 22 4 4 ALA ALA A . n A 1 23 ALA 23 5 5 ALA ALA A . n A 1 24 ALA 24 6 6 ALA ALA A . n A 1 25 LYS 25 7 7 LYS LYS A . n A 1 26 HIS 26 8 8 HIS HIS A . n A 1 27 LEU 27 9 9 LEU LEU A . n A 1 28 ILE 28 10 10 ILE ILE A . n A 1 29 GLU 29 11 11 GLU GLU A . n A 1 30 ARG 30 12 12 ARG ARG A . n A 1 31 TYR 31 13 13 TYR TYR A . n A 1 32 TYR 32 14 14 TYR TYR A . n A 1 33 HIS 33 15 15 HIS HIS A . n A 1 34 GLN 34 16 16 GLN GLN A . n A 1 35 LEU 35 17 17 LEU LEU A . n A 1 36 THR 36 18 18 THR THR A . n A 1 37 GLU 37 19 19 GLU GLU A . n A 1 38 GLY 38 20 20 GLY GLY A . n A 1 39 CYS 39 21 21 CYS CYS A . n A 1 40 GLY 40 22 22 GLY GLY A . n A 1 41 ASN 41 23 23 ASN ASN A . n A 1 42 GLU 42 24 24 GLU GLU A . n A 1 43 ALA 43 25 25 ALA ALA A . n A 1 44 CYS 44 26 26 CYS CYS A . n A 1 45 THR 45 27 27 THR THR A . n A 1 46 ASN 46 28 28 ASN ASN A . n A 1 47 GLU 47 29 29 GLU GLU A . n A 1 48 PHE 48 30 30 PHE PHE A . n A 1 49 CYS 49 31 31 CYS CYS A . n A 1 50 ALA 50 32 32 ALA ALA A . n A 1 51 SER 51 33 33 SER SER A . n A 1 52 CYS 52 34 34 CYS CYS A . n A 1 53 PRO 53 35 35 PRO PRO A . n A 1 54 THR 54 36 36 THR THR A . n A 1 55 PHE 55 37 37 PHE PHE A . n A 1 56 LEU 56 38 38 LEU LEU A . n A 1 57 ARG 57 39 39 ARG ARG A . n A 1 58 MET 58 40 40 MET MET A . n A 1 59 ASP 59 41 41 ASP ASP A . n A 1 60 ASN 60 42 42 ASN ASN A . n A 1 61 ASN 61 43 43 ASN ASN A . n A 1 62 ALA 62 44 44 ALA ALA A . n A 1 63 ALA 63 45 45 ALA ALA A . n A 1 64 ALA 64 46 46 ALA ALA A . n A 1 65 ILE 65 47 47 ILE ILE A . n A 1 66 LYS 66 48 48 LYS LYS A . n A 1 67 ALA 67 49 49 ALA ALA A . n A 1 68 LEU 68 50 50 LEU LEU A . n A 1 69 GLU 69 51 51 GLU GLU A . n A 1 70 LEU 70 52 52 LEU LEU A . n A 1 71 TYR 71 53 53 TYR TYR A . n A 1 72 LYS 72 54 54 LYS LYS A . n A 1 73 ILE 73 55 55 ILE ILE A . n A 1 74 ASN 74 56 56 ASN ASN A . n A 1 75 ALA 75 57 57 ALA ALA A . n A 1 76 LYS 76 58 58 LYS LYS A . n A 1 77 LEU 77 59 59 LEU LEU A . n A 1 78 CYS 78 60 60 CYS CYS A . n A 1 79 ASP 79 61 61 ASP ASP A . n A 1 80 PRO 80 62 62 PRO PRO A . n A 1 81 HIS 81 63 63 HIS HIS A . n A 1 82 PRO 82 64 64 PRO PRO A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG 'PSI, Protein Structure Initiative' 'Structural Genomics Consortium' 2 SGC ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 65 _pdbx_nonpoly_scheme.auth_seq_num 65 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 39 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 65 ? 1_555 SG ? A CYS 49 ? A CYS 31 ? 1_555 106.9 ? 2 SG ? A CYS 39 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 65 ? 1_555 SG ? A CYS 78 ? A CYS 60 ? 1_555 109.9 ? 3 SG ? A CYS 49 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 65 ? 1_555 SG ? A CYS 78 ? A CYS 60 ? 1_555 108.1 ? 4 SG ? A CYS 39 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 65 ? 1_555 SG ? A CYS 44 ? A CYS 26 ? 1_555 110.8 ? 5 SG ? A CYS 49 ? A CYS 31 ? 1_555 ZN ? B ZN . ? A ZN 65 ? 1_555 SG ? A CYS 44 ? A CYS 26 ? 1_555 110.4 ? 6 SG ? A CYS 78 ? A CYS 60 ? 1_555 ZN ? B ZN . ? A ZN 65 ? 1_555 SG ? A CYS 44 ? A CYS 26 ? 1_555 110.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-12-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-01-18 4 'Structure model' 1 3 2012-05-23 5 'Structure model' 1 4 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' pdbx_database_status 2 5 'Structure model' pdbx_nmr_software 3 5 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_pdbx_database_status.status_code_cs' 2 5 'Structure model' '_pdbx_nmr_software.name' 3 5 'Structure model' '_pdbx_nmr_spectrometer.model' 4 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id hs00184-1 0.5 ? mM '[U-13C; U-15N]' 1 mops-2 10 ? mM ? 1 'sodium chloride-3' 450 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.01 ? % ? 1 benzamidine-7 10 ? mM ? 1 D2O-8 10 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 27 ? ? -116.53 69.85 2 1 ARG A 39 ? ? -58.70 108.44 3 1 LYS A 58 ? ? -69.95 96.53 4 2 CYS A 21 ? ? -156.05 -1.80 5 2 ASN A 56 ? ? 61.72 60.99 6 3 ASN A 56 ? ? 56.28 73.64 7 3 ALA A 57 ? ? -78.74 -167.19 8 3 LYS A 58 ? ? -69.03 95.61 9 4 CYS A 21 ? ? -150.29 10.17 10 4 ALA A 25 ? ? -87.34 48.76 11 4 THR A 27 ? ? -82.95 31.12 12 5 GLU A 24 ? ? -57.91 -74.85 13 5 THR A 27 ? ? -92.55 56.33 14 6 ARG A 3 ? ? -90.44 31.45 15 6 CYS A 21 ? ? -153.36 2.37 16 6 THR A 27 ? ? -91.12 59.02 17 6 MET A 40 ? ? -105.96 -168.90 18 6 ASN A 56 ? ? 62.75 68.19 19 6 PRO A 62 ? ? -59.24 106.41 20 7 ASN A 23 ? ? -59.92 105.21 21 7 PHE A 30 ? ? -88.30 37.48 22 7 LYS A 58 ? ? -62.08 99.09 23 8 CYS A 21 ? ? -158.49 8.42 24 8 ALA A 25 ? ? -106.27 48.76 25 8 THR A 27 ? ? -114.95 78.47 26 8 LYS A 58 ? ? -66.53 96.52 27 9 LYS A 58 ? ? -64.67 95.77 28 10 CYS A 21 ? ? -149.15 -2.38 29 10 ALA A 25 ? ? -93.09 46.71 30 10 THR A 27 ? ? -86.17 42.19 31 10 PHE A 30 ? ? -88.23 39.14 32 10 LYS A 58 ? ? -58.44 105.43 33 10 PRO A 62 ? ? -59.55 109.46 34 11 CYS A 21 ? ? -158.43 14.70 35 11 ASN A 23 ? ? -54.33 108.69 36 11 PHE A 30 ? ? -88.49 49.90 37 11 LYS A 58 ? ? -59.80 102.35 38 12 GLU A 19 ? ? -91.05 -62.17 39 12 CYS A 21 ? ? -156.81 -0.93 40 12 GLU A 24 ? ? -60.54 -71.68 41 12 ASP A 61 ? ? 71.49 147.53 42 13 CYS A 21 ? ? -156.45 0.12 43 13 ALA A 25 ? ? -96.09 45.17 44 14 ALA A 25 ? ? -87.51 44.73 45 14 PHE A 30 ? ? -89.63 45.93 46 15 GLU A 19 ? ? -91.53 -61.64 47 15 CYS A 21 ? ? -158.92 1.06 48 15 LYS A 58 ? ? -57.83 95.66 49 16 CYS A 21 ? ? -154.35 1.30 50 16 ALA A 25 ? ? -92.31 46.78 51 16 CYS A 60 ? ? -106.19 41.62 52 17 ALA A 25 ? ? -104.92 54.43 53 17 THR A 27 ? ? -117.97 75.53 54 17 PHE A 30 ? ? -104.86 74.68 55 17 CYS A 31 ? ? -172.35 138.84 56 17 ASN A 56 ? ? 57.08 74.89 57 18 LYS A 2 ? ? 57.47 70.14 58 18 CYS A 21 ? ? -153.83 16.02 59 18 THR A 27 ? ? -110.45 62.43 60 18 LYS A 58 ? ? -63.38 94.44 61 19 CYS A 21 ? ? -155.61 18.06 62 19 ASN A 56 ? ? 60.47 74.05 63 20 CYS A 21 ? ? -151.59 12.18 64 20 THR A 27 ? ? -91.55 37.45 65 20 PHE A 30 ? ? -92.96 37.92 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -17 ? A MET 1 2 1 Y 1 A HIS -16 ? A HIS 2 3 1 Y 1 A HIS -15 ? A HIS 3 4 1 Y 1 A HIS -14 ? A HIS 4 5 1 Y 1 A HIS -13 ? A HIS 5 6 1 Y 1 A HIS -12 ? A HIS 6 7 1 Y 1 A HIS -11 ? A HIS 7 8 1 Y 1 A SER -10 ? A SER 8 9 1 Y 1 A SER -9 ? A SER 9 10 1 Y 1 A GLY -8 ? A GLY 10 11 1 Y 1 A ARG -7 ? A ARG 11 12 1 Y 1 A GLU -6 ? A GLU 12 13 1 Y 1 A ASN -5 ? A ASN 13 14 1 Y 1 A LEU -4 ? A LEU 14 15 1 Y 1 A TYR -3 ? A TYR 15 16 1 Y 1 A PHE -2 ? A PHE 16 17 1 Y 1 A GLN -1 ? A GLN 17 18 1 Y 1 A GLY 0 ? A GLY 18 19 2 Y 1 A MET -17 ? A MET 1 20 2 Y 1 A HIS -16 ? A HIS 2 21 2 Y 1 A HIS -15 ? A HIS 3 22 2 Y 1 A HIS -14 ? A HIS 4 23 2 Y 1 A HIS -13 ? A HIS 5 24 2 Y 1 A HIS -12 ? A HIS 6 25 2 Y 1 A HIS -11 ? A HIS 7 26 2 Y 1 A SER -10 ? A SER 8 27 2 Y 1 A SER -9 ? A SER 9 28 2 Y 1 A GLY -8 ? A GLY 10 29 2 Y 1 A ARG -7 ? A ARG 11 30 2 Y 1 A GLU -6 ? A GLU 12 31 2 Y 1 A ASN -5 ? A ASN 13 32 2 Y 1 A LEU -4 ? A LEU 14 33 2 Y 1 A TYR -3 ? A TYR 15 34 2 Y 1 A PHE -2 ? A PHE 16 35 2 Y 1 A GLN -1 ? A GLN 17 36 2 Y 1 A GLY 0 ? A GLY 18 37 3 Y 1 A MET -17 ? A MET 1 38 3 Y 1 A HIS -16 ? A HIS 2 39 3 Y 1 A HIS -15 ? A HIS 3 40 3 Y 1 A HIS -14 ? A HIS 4 41 3 Y 1 A HIS -13 ? A HIS 5 42 3 Y 1 A HIS -12 ? A HIS 6 43 3 Y 1 A HIS -11 ? A HIS 7 44 3 Y 1 A SER -10 ? A SER 8 45 3 Y 1 A SER -9 ? A SER 9 46 3 Y 1 A GLY -8 ? A GLY 10 47 3 Y 1 A ARG -7 ? A ARG 11 48 3 Y 1 A GLU -6 ? A GLU 12 49 3 Y 1 A ASN -5 ? A ASN 13 50 3 Y 1 A LEU -4 ? A LEU 14 51 3 Y 1 A TYR -3 ? A TYR 15 52 3 Y 1 A PHE -2 ? A PHE 16 53 3 Y 1 A GLN -1 ? A GLN 17 54 3 Y 1 A GLY 0 ? A GLY 18 55 4 Y 1 A MET -17 ? A MET 1 56 4 Y 1 A HIS -16 ? A HIS 2 57 4 Y 1 A HIS -15 ? A HIS 3 58 4 Y 1 A HIS -14 ? A HIS 4 59 4 Y 1 A HIS -13 ? A HIS 5 60 4 Y 1 A HIS -12 ? A HIS 6 61 4 Y 1 A HIS -11 ? A HIS 7 62 4 Y 1 A SER -10 ? A SER 8 63 4 Y 1 A SER -9 ? A SER 9 64 4 Y 1 A GLY -8 ? A GLY 10 65 4 Y 1 A ARG -7 ? A ARG 11 66 4 Y 1 A GLU -6 ? A GLU 12 67 4 Y 1 A ASN -5 ? A ASN 13 68 4 Y 1 A LEU -4 ? A LEU 14 69 4 Y 1 A TYR -3 ? A TYR 15 70 4 Y 1 A PHE -2 ? A PHE 16 71 4 Y 1 A GLN -1 ? A GLN 17 72 4 Y 1 A GLY 0 ? A GLY 18 73 5 Y 1 A MET -17 ? A MET 1 74 5 Y 1 A HIS -16 ? A HIS 2 75 5 Y 1 A HIS -15 ? A HIS 3 76 5 Y 1 A HIS -14 ? A HIS 4 77 5 Y 1 A HIS -13 ? A HIS 5 78 5 Y 1 A HIS -12 ? A HIS 6 79 5 Y 1 A HIS -11 ? A HIS 7 80 5 Y 1 A SER -10 ? A SER 8 81 5 Y 1 A SER -9 ? A SER 9 82 5 Y 1 A GLY -8 ? A GLY 10 83 5 Y 1 A ARG -7 ? A ARG 11 84 5 Y 1 A GLU -6 ? A GLU 12 85 5 Y 1 A ASN -5 ? A ASN 13 86 5 Y 1 A LEU -4 ? A LEU 14 87 5 Y 1 A TYR -3 ? A TYR 15 88 5 Y 1 A PHE -2 ? A PHE 16 89 5 Y 1 A GLN -1 ? A GLN 17 90 5 Y 1 A GLY 0 ? A GLY 18 91 6 Y 1 A MET -17 ? A MET 1 92 6 Y 1 A HIS -16 ? A HIS 2 93 6 Y 1 A HIS -15 ? A HIS 3 94 6 Y 1 A HIS -14 ? A HIS 4 95 6 Y 1 A HIS -13 ? A HIS 5 96 6 Y 1 A HIS -12 ? A HIS 6 97 6 Y 1 A HIS -11 ? A HIS 7 98 6 Y 1 A SER -10 ? A SER 8 99 6 Y 1 A SER -9 ? A SER 9 100 6 Y 1 A GLY -8 ? A GLY 10 101 6 Y 1 A ARG -7 ? A ARG 11 102 6 Y 1 A GLU -6 ? A GLU 12 103 6 Y 1 A ASN -5 ? A ASN 13 104 6 Y 1 A LEU -4 ? A LEU 14 105 6 Y 1 A TYR -3 ? A TYR 15 106 6 Y 1 A PHE -2 ? A PHE 16 107 6 Y 1 A GLN -1 ? A GLN 17 108 6 Y 1 A GLY 0 ? A GLY 18 109 7 Y 1 A MET -17 ? A MET 1 110 7 Y 1 A HIS -16 ? A HIS 2 111 7 Y 1 A HIS -15 ? A HIS 3 112 7 Y 1 A HIS -14 ? A HIS 4 113 7 Y 1 A HIS -13 ? A HIS 5 114 7 Y 1 A HIS -12 ? A HIS 6 115 7 Y 1 A HIS -11 ? A HIS 7 116 7 Y 1 A SER -10 ? A SER 8 117 7 Y 1 A SER -9 ? A SER 9 118 7 Y 1 A GLY -8 ? A GLY 10 119 7 Y 1 A ARG -7 ? A ARG 11 120 7 Y 1 A GLU -6 ? A GLU 12 121 7 Y 1 A ASN -5 ? A ASN 13 122 7 Y 1 A LEU -4 ? A LEU 14 123 7 Y 1 A TYR -3 ? A TYR 15 124 7 Y 1 A PHE -2 ? A PHE 16 125 7 Y 1 A GLN -1 ? A GLN 17 126 7 Y 1 A GLY 0 ? A GLY 18 127 8 Y 1 A MET -17 ? A MET 1 128 8 Y 1 A HIS -16 ? A HIS 2 129 8 Y 1 A HIS -15 ? A HIS 3 130 8 Y 1 A HIS -14 ? A HIS 4 131 8 Y 1 A HIS -13 ? A HIS 5 132 8 Y 1 A HIS -12 ? A HIS 6 133 8 Y 1 A HIS -11 ? A HIS 7 134 8 Y 1 A SER -10 ? A SER 8 135 8 Y 1 A SER -9 ? A SER 9 136 8 Y 1 A GLY -8 ? A GLY 10 137 8 Y 1 A ARG -7 ? A ARG 11 138 8 Y 1 A GLU -6 ? A GLU 12 139 8 Y 1 A ASN -5 ? A ASN 13 140 8 Y 1 A LEU -4 ? A LEU 14 141 8 Y 1 A TYR -3 ? A TYR 15 142 8 Y 1 A PHE -2 ? A PHE 16 143 8 Y 1 A GLN -1 ? A GLN 17 144 8 Y 1 A GLY 0 ? A GLY 18 145 9 Y 1 A MET -17 ? A MET 1 146 9 Y 1 A HIS -16 ? A HIS 2 147 9 Y 1 A HIS -15 ? A HIS 3 148 9 Y 1 A HIS -14 ? A HIS 4 149 9 Y 1 A HIS -13 ? A HIS 5 150 9 Y 1 A HIS -12 ? A HIS 6 151 9 Y 1 A HIS -11 ? A HIS 7 152 9 Y 1 A SER -10 ? A SER 8 153 9 Y 1 A SER -9 ? A SER 9 154 9 Y 1 A GLY -8 ? A GLY 10 155 9 Y 1 A ARG -7 ? A ARG 11 156 9 Y 1 A GLU -6 ? A GLU 12 157 9 Y 1 A ASN -5 ? A ASN 13 158 9 Y 1 A LEU -4 ? A LEU 14 159 9 Y 1 A TYR -3 ? A TYR 15 160 9 Y 1 A PHE -2 ? A PHE 16 161 9 Y 1 A GLN -1 ? A GLN 17 162 9 Y 1 A GLY 0 ? A GLY 18 163 10 Y 1 A MET -17 ? A MET 1 164 10 Y 1 A HIS -16 ? A HIS 2 165 10 Y 1 A HIS -15 ? A HIS 3 166 10 Y 1 A HIS -14 ? A HIS 4 167 10 Y 1 A HIS -13 ? A HIS 5 168 10 Y 1 A HIS -12 ? A HIS 6 169 10 Y 1 A HIS -11 ? A HIS 7 170 10 Y 1 A SER -10 ? A SER 8 171 10 Y 1 A SER -9 ? A SER 9 172 10 Y 1 A GLY -8 ? A GLY 10 173 10 Y 1 A ARG -7 ? A ARG 11 174 10 Y 1 A GLU -6 ? A GLU 12 175 10 Y 1 A ASN -5 ? A ASN 13 176 10 Y 1 A LEU -4 ? A LEU 14 177 10 Y 1 A TYR -3 ? A TYR 15 178 10 Y 1 A PHE -2 ? A PHE 16 179 10 Y 1 A GLN -1 ? A GLN 17 180 10 Y 1 A GLY 0 ? A GLY 18 181 11 Y 1 A MET -17 ? A MET 1 182 11 Y 1 A HIS -16 ? A HIS 2 183 11 Y 1 A HIS -15 ? A HIS 3 184 11 Y 1 A HIS -14 ? A HIS 4 185 11 Y 1 A HIS -13 ? A HIS 5 186 11 Y 1 A HIS -12 ? A HIS 6 187 11 Y 1 A HIS -11 ? A HIS 7 188 11 Y 1 A SER -10 ? A SER 8 189 11 Y 1 A SER -9 ? A SER 9 190 11 Y 1 A GLY -8 ? A GLY 10 191 11 Y 1 A ARG -7 ? A ARG 11 192 11 Y 1 A GLU -6 ? A GLU 12 193 11 Y 1 A ASN -5 ? A ASN 13 194 11 Y 1 A LEU -4 ? A LEU 14 195 11 Y 1 A TYR -3 ? A TYR 15 196 11 Y 1 A PHE -2 ? A PHE 16 197 11 Y 1 A GLN -1 ? A GLN 17 198 11 Y 1 A GLY 0 ? A GLY 18 199 12 Y 1 A MET -17 ? A MET 1 200 12 Y 1 A HIS -16 ? A HIS 2 201 12 Y 1 A HIS -15 ? A HIS 3 202 12 Y 1 A HIS -14 ? A HIS 4 203 12 Y 1 A HIS -13 ? A HIS 5 204 12 Y 1 A HIS -12 ? A HIS 6 205 12 Y 1 A HIS -11 ? A HIS 7 206 12 Y 1 A SER -10 ? A SER 8 207 12 Y 1 A SER -9 ? A SER 9 208 12 Y 1 A GLY -8 ? A GLY 10 209 12 Y 1 A ARG -7 ? A ARG 11 210 12 Y 1 A GLU -6 ? A GLU 12 211 12 Y 1 A ASN -5 ? A ASN 13 212 12 Y 1 A LEU -4 ? A LEU 14 213 12 Y 1 A TYR -3 ? A TYR 15 214 12 Y 1 A PHE -2 ? A PHE 16 215 12 Y 1 A GLN -1 ? A GLN 17 216 12 Y 1 A GLY 0 ? A GLY 18 217 13 Y 1 A MET -17 ? A MET 1 218 13 Y 1 A HIS -16 ? A HIS 2 219 13 Y 1 A HIS -15 ? A HIS 3 220 13 Y 1 A HIS -14 ? A HIS 4 221 13 Y 1 A HIS -13 ? A HIS 5 222 13 Y 1 A HIS -12 ? A HIS 6 223 13 Y 1 A HIS -11 ? A HIS 7 224 13 Y 1 A SER -10 ? A SER 8 225 13 Y 1 A SER -9 ? A SER 9 226 13 Y 1 A GLY -8 ? A GLY 10 227 13 Y 1 A ARG -7 ? A ARG 11 228 13 Y 1 A GLU -6 ? A GLU 12 229 13 Y 1 A ASN -5 ? A ASN 13 230 13 Y 1 A LEU -4 ? A LEU 14 231 13 Y 1 A TYR -3 ? A TYR 15 232 13 Y 1 A PHE -2 ? A PHE 16 233 13 Y 1 A GLN -1 ? A GLN 17 234 13 Y 1 A GLY 0 ? A GLY 18 235 14 Y 1 A MET -17 ? A MET 1 236 14 Y 1 A HIS -16 ? A HIS 2 237 14 Y 1 A HIS -15 ? A HIS 3 238 14 Y 1 A HIS -14 ? A HIS 4 239 14 Y 1 A HIS -13 ? A HIS 5 240 14 Y 1 A HIS -12 ? A HIS 6 241 14 Y 1 A HIS -11 ? A HIS 7 242 14 Y 1 A SER -10 ? A SER 8 243 14 Y 1 A SER -9 ? A SER 9 244 14 Y 1 A GLY -8 ? A GLY 10 245 14 Y 1 A ARG -7 ? A ARG 11 246 14 Y 1 A GLU -6 ? A GLU 12 247 14 Y 1 A ASN -5 ? A ASN 13 248 14 Y 1 A LEU -4 ? A LEU 14 249 14 Y 1 A TYR -3 ? A TYR 15 250 14 Y 1 A PHE -2 ? A PHE 16 251 14 Y 1 A GLN -1 ? A GLN 17 252 14 Y 1 A GLY 0 ? A GLY 18 253 15 Y 1 A MET -17 ? A MET 1 254 15 Y 1 A HIS -16 ? A HIS 2 255 15 Y 1 A HIS -15 ? A HIS 3 256 15 Y 1 A HIS -14 ? A HIS 4 257 15 Y 1 A HIS -13 ? A HIS 5 258 15 Y 1 A HIS -12 ? A HIS 6 259 15 Y 1 A HIS -11 ? A HIS 7 260 15 Y 1 A SER -10 ? A SER 8 261 15 Y 1 A SER -9 ? A SER 9 262 15 Y 1 A GLY -8 ? A GLY 10 263 15 Y 1 A ARG -7 ? A ARG 11 264 15 Y 1 A GLU -6 ? A GLU 12 265 15 Y 1 A ASN -5 ? A ASN 13 266 15 Y 1 A LEU -4 ? A LEU 14 267 15 Y 1 A TYR -3 ? A TYR 15 268 15 Y 1 A PHE -2 ? A PHE 16 269 15 Y 1 A GLN -1 ? A GLN 17 270 15 Y 1 A GLY 0 ? A GLY 18 271 16 Y 1 A MET -17 ? A MET 1 272 16 Y 1 A HIS -16 ? A HIS 2 273 16 Y 1 A HIS -15 ? A HIS 3 274 16 Y 1 A HIS -14 ? A HIS 4 275 16 Y 1 A HIS -13 ? A HIS 5 276 16 Y 1 A HIS -12 ? A HIS 6 277 16 Y 1 A HIS -11 ? A HIS 7 278 16 Y 1 A SER -10 ? A SER 8 279 16 Y 1 A SER -9 ? A SER 9 280 16 Y 1 A GLY -8 ? A GLY 10 281 16 Y 1 A ARG -7 ? A ARG 11 282 16 Y 1 A GLU -6 ? A GLU 12 283 16 Y 1 A ASN -5 ? A ASN 13 284 16 Y 1 A LEU -4 ? A LEU 14 285 16 Y 1 A TYR -3 ? A TYR 15 286 16 Y 1 A PHE -2 ? A PHE 16 287 16 Y 1 A GLN -1 ? A GLN 17 288 16 Y 1 A GLY 0 ? A GLY 18 289 17 Y 1 A MET -17 ? A MET 1 290 17 Y 1 A HIS -16 ? A HIS 2 291 17 Y 1 A HIS -15 ? A HIS 3 292 17 Y 1 A HIS -14 ? A HIS 4 293 17 Y 1 A HIS -13 ? A HIS 5 294 17 Y 1 A HIS -12 ? A HIS 6 295 17 Y 1 A HIS -11 ? A HIS 7 296 17 Y 1 A SER -10 ? A SER 8 297 17 Y 1 A SER -9 ? A SER 9 298 17 Y 1 A GLY -8 ? A GLY 10 299 17 Y 1 A ARG -7 ? A ARG 11 300 17 Y 1 A GLU -6 ? A GLU 12 301 17 Y 1 A ASN -5 ? A ASN 13 302 17 Y 1 A LEU -4 ? A LEU 14 303 17 Y 1 A TYR -3 ? A TYR 15 304 17 Y 1 A PHE -2 ? A PHE 16 305 17 Y 1 A GLN -1 ? A GLN 17 306 17 Y 1 A GLY 0 ? A GLY 18 307 18 Y 1 A MET -17 ? A MET 1 308 18 Y 1 A HIS -16 ? A HIS 2 309 18 Y 1 A HIS -15 ? A HIS 3 310 18 Y 1 A HIS -14 ? A HIS 4 311 18 Y 1 A HIS -13 ? A HIS 5 312 18 Y 1 A HIS -12 ? A HIS 6 313 18 Y 1 A HIS -11 ? A HIS 7 314 18 Y 1 A SER -10 ? A SER 8 315 18 Y 1 A SER -9 ? A SER 9 316 18 Y 1 A GLY -8 ? A GLY 10 317 18 Y 1 A ARG -7 ? A ARG 11 318 18 Y 1 A GLU -6 ? A GLU 12 319 18 Y 1 A ASN -5 ? A ASN 13 320 18 Y 1 A LEU -4 ? A LEU 14 321 18 Y 1 A TYR -3 ? A TYR 15 322 18 Y 1 A PHE -2 ? A PHE 16 323 18 Y 1 A GLN -1 ? A GLN 17 324 18 Y 1 A GLY 0 ? A GLY 18 325 19 Y 1 A MET -17 ? A MET 1 326 19 Y 1 A HIS -16 ? A HIS 2 327 19 Y 1 A HIS -15 ? A HIS 3 328 19 Y 1 A HIS -14 ? A HIS 4 329 19 Y 1 A HIS -13 ? A HIS 5 330 19 Y 1 A HIS -12 ? A HIS 6 331 19 Y 1 A HIS -11 ? A HIS 7 332 19 Y 1 A SER -10 ? A SER 8 333 19 Y 1 A SER -9 ? A SER 9 334 19 Y 1 A GLY -8 ? A GLY 10 335 19 Y 1 A ARG -7 ? A ARG 11 336 19 Y 1 A GLU -6 ? A GLU 12 337 19 Y 1 A ASN -5 ? A ASN 13 338 19 Y 1 A LEU -4 ? A LEU 14 339 19 Y 1 A TYR -3 ? A TYR 15 340 19 Y 1 A PHE -2 ? A PHE 16 341 19 Y 1 A GLN -1 ? A GLN 17 342 19 Y 1 A GLY 0 ? A GLY 18 343 20 Y 1 A MET -17 ? A MET 1 344 20 Y 1 A HIS -16 ? A HIS 2 345 20 Y 1 A HIS -15 ? A HIS 3 346 20 Y 1 A HIS -14 ? A HIS 4 347 20 Y 1 A HIS -13 ? A HIS 5 348 20 Y 1 A HIS -12 ? A HIS 6 349 20 Y 1 A HIS -11 ? A HIS 7 350 20 Y 1 A SER -10 ? A SER 8 351 20 Y 1 A SER -9 ? A SER 9 352 20 Y 1 A GLY -8 ? A GLY 10 353 20 Y 1 A ARG -7 ? A ARG 11 354 20 Y 1 A GLU -6 ? A GLU 12 355 20 Y 1 A ASN -5 ? A ASN 13 356 20 Y 1 A LEU -4 ? A LEU 14 357 20 Y 1 A TYR -3 ? A TYR 15 358 20 Y 1 A PHE -2 ? A PHE 16 359 20 Y 1 A GLN -1 ? A GLN 17 360 20 Y 1 A GLY 0 ? A GLY 18 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #