data_2KR4 # _entry.id 2KR4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KR4 pdb_00002kr4 10.2210/pdb2kr4/pdb RCSB RCSB101469 ? ? WWPDB D_1000101469 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KR4 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-12-03 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nordquist, K.' 1 'Soss, S.' 2 'Chazin, W.' 3 # _citation.id primary _citation.title 'Structural and functional characterization of the monomeric U-box domain from E4B.' _citation.journal_abbrev Biochemistry _citation.journal_volume 49 _citation.page_first 347 _citation.page_last 355 _citation.year 2010 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20017557 _citation.pdbx_database_id_DOI 10.1021/bi901620v # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nordquist, K.A.' 1 ? primary 'Dimitrova, Y.N.' 2 ? primary 'Brzovic, P.S.' 3 ? primary 'Ridenour, W.B.' 4 ? primary 'Munro, K.A.' 5 ? primary 'Soss, S.E.' 6 ? primary 'Caprioli, R.M.' 7 ? primary 'Klevit, R.E.' 8 ? primary 'Chazin, W.J.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ubiquitin conjugation factor E4 B' _entity.formula_weight 9778.996 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'U-Box Domain (UNP residues 1092-1173)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ubiquitin fusion degradation protein 2, Ufd2a' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PGSAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREK QSSDH ; _entity_poly.pdbx_seq_one_letter_code_can ;PGSAEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREK QSSDH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLY n 1 3 SER n 1 4 ALA n 1 5 GLU n 1 6 ILE n 1 7 ASP n 1 8 TYR n 1 9 SER n 1 10 ASP n 1 11 ALA n 1 12 PRO n 1 13 ASP n 1 14 GLU n 1 15 PHE n 1 16 ARG n 1 17 ASP n 1 18 PRO n 1 19 LEU n 1 20 MET n 1 21 ASP n 1 22 THR n 1 23 LEU n 1 24 MET n 1 25 THR n 1 26 ASP n 1 27 PRO n 1 28 VAL n 1 29 ARG n 1 30 LEU n 1 31 PRO n 1 32 SER n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 MET n 1 37 ASP n 1 38 ARG n 1 39 SER n 1 40 ILE n 1 41 ILE n 1 42 LEU n 1 43 ARG n 1 44 HIS n 1 45 LEU n 1 46 LEU n 1 47 ASN n 1 48 SER n 1 49 PRO n 1 50 THR n 1 51 ASP n 1 52 PRO n 1 53 PHE n 1 54 ASN n 1 55 ARG n 1 56 GLN n 1 57 MET n 1 58 LEU n 1 59 THR n 1 60 GLU n 1 61 SER n 1 62 MET n 1 63 LEU n 1 64 GLU n 1 65 PRO n 1 66 VAL n 1 67 PRO n 1 68 GLU n 1 69 LEU n 1 70 LYS n 1 71 GLU n 1 72 GLN n 1 73 ILE n 1 74 GLN n 1 75 ALA n 1 76 TRP n 1 77 MET n 1 78 ARG n 1 79 GLU n 1 80 LYS n 1 81 GLN n 1 82 SER n 1 83 SER n 1 84 ASP n 1 85 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ube4b, Ufd2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pBG102 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description '6xHIS-SUMO tag with H3C protease cleavage site' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code UBE4B_MOUSE _struct_ref.pdbx_db_accession Q9ES00 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEIDYSDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESMLEPVPELKEQIQAWMREKQSS DH ; _struct_ref.pdbx_align_begin 1092 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KR4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9ES00 _struct_ref_seq.db_align_beg 1092 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1173 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KR4 PRO A 1 ? UNP Q9ES00 ? ? 'expression tag' 1 1 1 2KR4 GLY A 2 ? UNP Q9ES00 ? ? 'expression tag' 2 2 1 2KR4 SER A 3 ? UNP Q9ES00 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D DQF-COSY' 1 4 2 '2D 1H-1H NOESY' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '750 uM [U-100% 13C; U-100% 15N] U-box domain of E4B, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM U-box domain of E4B, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KR4 _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ;Computed through AMBER9 in water, Computed through AMBER9 in water. Single residues in some models have phi-psi angle combinations that are outside the norm. These are found only for residues that lack experimental constraints and which are therefore poorly defined in the structure. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KR4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KR4 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2009.015.15.35 1 Goddard 'chemical shift assignment' Sparky 3.113 2 Goddard 'peak picking' Sparky 3.113 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2..1 4 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 9 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KR4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KR4 _struct.title 'U-box domain of the E3 Ubiquitin Ligase E4B' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KR4 _struct_keywords.pdbx_keywords LIGASE _struct_keywords.text 'U-box, E4B, Ufd2, RING, Ubiquitin, E3 Ligase, Ubl conjugation pathway, LIGASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 38 ? SER A 48 ? ARG A 38 SER A 48 1 ? 11 HELX_P HELX_P2 2 THR A 59 ? LEU A 63 ? THR A 59 LEU A 63 5 ? 5 HELX_P HELX_P3 3 VAL A 66 ? SER A 83 ? VAL A 66 SER A 83 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 1 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 1 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 GLY _struct_mon_prot_cis.pdbx_label_seq_id_2 2 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 GLY _struct_mon_prot_cis.pdbx_auth_seq_id_2 2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 15 _struct_mon_prot_cis.pdbx_omega_angle -1.03 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 35 ? ASP A 37 ? VAL A 35 ASP A 37 A 2 PRO A 27 ? ARG A 29 ? PRO A 27 ARG A 29 A 3 GLU A 64 ? PRO A 65 ? GLU A 64 PRO A 65 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O MET A 36 ? O MET A 36 N VAL A 28 ? N VAL A 28 A 2 3 N ARG A 29 ? N ARG A 29 O GLU A 64 ? O GLU A 64 # _atom_sites.entry_id 2KR4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 MET 57 57 57 MET MET A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 HIS 85 85 85 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-01-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'U-box domain of E4B-1' 750 ? uM '[U-100% 13C; U-100% 15N]' 1 'U-box domain of E4B-2' 1 ? mM ? 2 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.37 111.50 -9.13 1.40 N 2 2 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.23 111.50 -9.27 1.40 N 3 2 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.36 120.30 3.06 0.50 N 4 3 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 101.79 111.50 -9.71 1.40 N 5 4 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.39 111.50 -9.11 1.40 N 6 5 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.60 111.50 -8.90 1.40 N 7 6 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.40 111.50 -9.10 1.40 N 8 7 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 101.79 111.50 -9.71 1.40 N 9 8 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.37 111.50 -9.13 1.40 N 10 8 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.91 120.30 3.61 0.50 N 11 8 NE A ARG 78 ? ? CZ A ARG 78 ? ? NH1 A ARG 78 ? ? 123.73 120.30 3.43 0.50 N 12 9 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.21 111.50 -9.29 1.40 N 13 10 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.14 111.50 -9.36 1.40 N 14 11 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.80 120.30 3.50 0.50 N 15 13 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.28 111.50 -9.22 1.40 N 16 13 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.37 120.30 3.07 0.50 N 17 14 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.17 111.50 -9.33 1.40 N 18 14 NE A ARG 16 ? ? CZ A ARG 16 ? ? NH1 A ARG 16 ? ? 123.44 120.30 3.14 0.50 N 19 15 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.32 111.50 -9.18 1.40 N 20 16 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.31 111.50 -9.19 1.40 N 21 18 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.67 111.50 -8.83 1.40 N 22 19 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.36 111.50 -9.14 1.40 N 23 19 NE A ARG 29 ? ? CZ A ARG 29 ? ? NH1 A ARG 29 ? ? 123.31 120.30 3.01 0.50 N 24 20 CA A PRO 1 ? ? N A PRO 1 ? ? CD A PRO 1 ? ? 102.64 111.50 -8.86 1.40 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 25 ? ? 71.70 -35.49 2 1 ASN A 54 ? ? -154.00 -27.40 3 2 TYR A 8 ? ? -77.75 48.99 4 2 THR A 25 ? ? 55.04 -16.87 5 2 ASP A 26 ? ? -117.86 73.54 6 2 SER A 82 ? ? 70.79 -5.89 7 2 ASP A 84 ? ? 81.26 163.15 8 3 TYR A 8 ? ? -77.65 27.87 9 3 THR A 25 ? ? 67.36 -27.73 10 4 ASP A 21 ? ? 73.78 -2.87 11 4 THR A 25 ? ? 72.23 -42.27 12 5 TYR A 8 ? ? -77.31 43.31 13 5 THR A 25 ? ? 75.39 -40.78 14 5 SER A 83 ? ? 70.11 -26.30 15 6 LEU A 19 ? ? -132.90 -53.04 16 6 THR A 25 ? ? 71.50 -31.70 17 7 THR A 25 ? ? 57.18 -20.64 18 7 ASP A 84 ? ? 90.03 158.47 19 8 TYR A 8 ? ? -77.79 31.43 20 8 THR A 25 ? ? 71.87 -39.71 21 9 GLU A 5 ? ? 66.47 171.73 22 9 ASP A 21 ? ? 68.64 -1.62 23 9 THR A 25 ? ? 59.66 -29.90 24 9 ASN A 54 ? ? -159.33 -17.93 25 10 THR A 25 ? ? 57.06 -19.70 26 11 THR A 25 ? ? 65.48 -26.12 27 12 THR A 25 ? ? 57.47 -23.84 28 12 ASP A 84 ? ? 66.03 -81.96 29 13 ASP A 21 ? ? 74.56 -1.64 30 13 THR A 25 ? ? 64.22 -26.50 31 13 ASP A 26 ? ? -119.45 78.67 32 13 SER A 82 ? ? 76.65 -38.79 33 13 SER A 83 ? ? 77.07 -3.89 34 14 THR A 25 ? ? 71.48 -29.48 35 15 SER A 3 ? ? 75.41 -4.59 36 15 THR A 25 ? ? 66.96 -28.82 37 15 SER A 82 ? ? 131.27 138.66 38 16 ASP A 7 ? ? 75.01 -9.79 39 16 THR A 25 ? ? 73.35 -34.52 40 17 THR A 25 ? ? 74.07 -36.16 41 18 THR A 25 ? ? 65.19 -31.70 42 18 SER A 82 ? ? -167.52 -25.40 43 19 THR A 25 ? ? 66.69 -23.00 44 20 THR A 25 ? ? 73.31 -37.34 45 20 ASP A 26 ? ? -115.90 79.69 46 20 SER A 82 ? ? -166.70 -139.86 47 20 SER A 83 ? ? 73.03 -37.86 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 15 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 55 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.081 _pdbx_validate_planes.type 'SIDE CHAIN' #