data_2KRT # _entry.id 2KRT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KRT pdb_00002krt 10.2210/pdb2krt/pdb RCSB RCSB101494 ? ? WWPDB D_1000101494 ? ? BMRB 16648 ? 10.13018/BMR16648 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-01-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KRT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-12-22 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified UuR17A TargetDB . unspecified 16648 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mani, R.' 1 'Swapna, G.' 2 'Janjua, H.' 3 'Ciccosanti, C.' 4 'Huang, Y.' 5 'Patel, D.' 6 'Xiao, R.' 7 'Acton, T.' 8 'Everett, J.' 9 'Montelione, G.T.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title ;NMR Solution Structure of a Conserved Hypothetical Membrane Lipoprotein obtained from Ureaplasma parvum : Northeast Structural Genomics Consortium Target UuR17A (139-239) ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mani, R.' 1 ? primary 'Swapna, G.' 2 ? primary 'Janjua, H.' 3 ? primary 'Ciccosanti, C.' 4 ? primary 'Huang, Y.' 5 ? primary 'Patel, D.' 6 ? primary 'Xiao, R.' 7 ? primary 'Acton, T.' 8 ? primary 'Everett, J.' 9 ? primary 'Montelione, G.T.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Conserved hypothetical membrane lipoprotein' _entity.formula_weight 14356.188 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 128-239' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANK NGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MLSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANK NGTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPYLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier UuR17A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LEU n 1 3 SER n 1 4 GLN n 1 5 ALA n 1 6 ASN n 1 7 GLU n 1 8 ASP n 1 9 PHE n 1 10 LYS n 1 11 LYS n 1 12 ILE n 1 13 VAL n 1 14 ASN n 1 15 ASN n 1 16 ILE n 1 17 ARG n 1 18 LEU n 1 19 LYS n 1 20 ASP n 1 21 THR n 1 22 PHE n 1 23 ASP n 1 24 PHE n 1 25 LYS n 1 26 LEU n 1 27 ALA n 1 28 ALA n 1 29 PHE n 1 30 PRO n 1 31 ASN n 1 32 GLN n 1 33 ASN n 1 34 TYR n 1 35 ASP n 1 36 GLN n 1 37 LEU n 1 38 LEU n 1 39 PRO n 1 40 SER n 1 41 GLN n 1 42 ILE n 1 43 TYR n 1 44 LYS n 1 45 ASN n 1 46 TYR n 1 47 TYR n 1 48 GLN n 1 49 GLY n 1 50 ILE n 1 51 GLU n 1 52 ILE n 1 53 GLN n 1 54 GLN n 1 55 HIS n 1 56 LYS n 1 57 TYR n 1 58 GLN n 1 59 ASN n 1 60 GLU n 1 61 LEU n 1 62 ASP n 1 63 ILE n 1 64 LYS n 1 65 ILE n 1 66 ILE n 1 67 ASN n 1 68 PHE n 1 69 LEU n 1 70 TYR n 1 71 PRO n 1 72 ASP n 1 73 GLY n 1 74 ASP n 1 75 PHE n 1 76 GLY n 1 77 SER n 1 78 ALA n 1 79 ASN n 1 80 LYS n 1 81 ASN n 1 82 GLY n 1 83 THR n 1 84 LEU n 1 85 LYS n 1 86 LEU n 1 87 SER n 1 88 LEU n 1 89 MET n 1 90 LEU n 1 91 THR n 1 92 ASP n 1 93 LYS n 1 94 LYS n 1 95 ASN n 1 96 ASN n 1 97 GLN n 1 98 VAL n 1 99 TYR n 1 100 TYR n 1 101 LYS n 1 102 LEU n 1 103 LEU n 1 104 GLU n 1 105 VAL n 1 106 SER n 1 107 GLY n 1 108 PHE n 1 109 LYS n 1 110 SER n 1 111 ASN n 1 112 PRO n 1 113 TYR n 1 114 LEU n 1 115 GLU n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n 1 121 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Ureaplasma urealyticum biotype 1' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene UU045 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ureaplasma parvum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 134821 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 MET 89 89 89 MET MET A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 TYR 113 113 113 TYR TYR A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 HIS 121 121 121 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KRT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KRT _struct.title ;Solution NMR Structure of a Conserved Hypothetical Membrane Lipoprotein Obtained from Ureaplasma parvum: Northeast Structural Genomics Consortium Target UuR17A (139-239) ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KRT _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text ;Lipoprotein, NESG, UuR17A, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, LIPID BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9PRA0_UREPA _struct_ref.pdbx_db_accession Q9PRA0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LSQANEDFKKIVNNIRLKDTFDFKLAAFPNQNYDQLLPSQIYKNYYQGIEIQQHKYQNELDIKIINFLYPDGDFGSANKN GTLKLSLMLTDKKNNQVYYKLLEVSGFKSNPY ; _struct_ref.pdbx_align_begin 128 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KRT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 113 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9PRA0 _struct_ref_seq.db_align_beg 128 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 239 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 113 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KRT MET A 1 ? UNP Q9PRA0 ? ? 'expression tag' 1 1 1 2KRT LEU A 114 ? UNP Q9PRA0 ? ? 'expression tag' 114 2 1 2KRT GLU A 115 ? UNP Q9PRA0 ? ? 'expression tag' 115 3 1 2KRT HIS A 116 ? UNP Q9PRA0 ? ? 'expression tag' 116 4 1 2KRT HIS A 117 ? UNP Q9PRA0 ? ? 'expression tag' 117 5 1 2KRT HIS A 118 ? UNP Q9PRA0 ? ? 'expression tag' 118 6 1 2KRT HIS A 119 ? UNP Q9PRA0 ? ? 'expression tag' 119 7 1 2KRT HIS A 120 ? UNP Q9PRA0 ? ? 'expression tag' 120 8 1 2KRT HIS A 121 ? UNP Q9PRA0 ? ? 'expression tag' 121 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 5 ? ASN A 15 ? ALA A 5 ASN A 15 1 ? 11 HELX_P HELX_P2 2 LEU A 38 ? LYS A 44 ? LEU A 38 LYS A 44 1 ? 7 HELX_P HELX_P3 3 ASP A 74 ? GLY A 82 ? ASP A 74 GLY A 82 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 22 ? LEU A 26 ? PHE A 22 LEU A 26 A 2 ILE A 50 ? GLN A 54 ? ILE A 50 GLN A 54 B 1 LEU A 61 ? ASP A 62 ? LEU A 61 ASP A 62 B 2 THR A 83 ? ASP A 92 ? THR A 83 ASP A 92 B 3 ILE A 65 ? LEU A 69 ? ILE A 65 LEU A 69 C 1 LEU A 61 ? ASP A 62 ? LEU A 61 ASP A 62 C 2 THR A 83 ? ASP A 92 ? THR A 83 ASP A 92 C 3 VAL A 98 ? SER A 106 ? VAL A 98 SER A 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 25 ? N LYS A 25 O GLU A 51 ? O GLU A 51 B 1 2 N ASP A 62 ? N ASP A 62 O THR A 91 ? O THR A 91 B 2 3 O SER A 87 ? O SER A 87 N ILE A 66 ? N ILE A 66 C 1 2 N ASP A 62 ? N ASP A 62 O THR A 91 ? O THR A 91 C 2 3 N LEU A 90 ? N LEU A 90 O TYR A 99 ? O TYR A 99 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? 55.30 95.18 2 1 GLN A 4 ? ? -106.17 55.61 3 1 LYS A 19 ? ? -135.10 -43.91 4 1 GLN A 36 ? ? -146.94 -33.20 5 1 HIS A 55 ? ? -142.65 -25.47 6 1 TYR A 57 ? ? -65.03 73.44 7 1 SER A 110 ? ? -161.60 102.62 8 1 ASN A 111 ? ? -116.72 74.75 9 1 HIS A 116 ? ? -145.07 37.91 10 2 SER A 3 ? ? -116.77 -77.19 11 2 LEU A 18 ? ? -70.94 20.12 12 2 LYS A 19 ? ? -151.32 -40.42 13 2 TYR A 34 ? ? -56.98 -9.54 14 2 GLN A 36 ? ? -142.76 -35.11 15 2 LYS A 56 ? ? -80.58 -159.58 16 2 TYR A 57 ? ? -58.51 67.04 17 2 PRO A 71 ? ? -74.94 42.25 18 2 ASP A 72 ? ? -175.42 -58.27 19 2 ASP A 92 ? ? -63.50 98.69 20 2 SER A 110 ? ? -157.92 58.16 21 2 ASN A 111 ? ? -115.90 73.94 22 2 GLU A 115 ? ? -69.20 91.17 23 3 ASP A 20 ? ? -92.69 -61.97 24 3 TYR A 57 ? ? -63.81 91.15 25 3 ILE A 66 ? ? -96.18 -62.17 26 3 LYS A 109 ? ? -162.19 103.21 27 3 PRO A 112 ? ? -65.25 -79.98 28 3 HIS A 117 ? ? -84.38 -70.73 29 3 HIS A 119 ? ? 51.08 84.70 30 4 ILE A 16 ? ? -68.03 90.38 31 4 LEU A 18 ? ? -73.39 30.95 32 4 LYS A 19 ? ? -166.98 -42.67 33 4 THR A 21 ? ? -122.80 -50.76 34 4 TYR A 34 ? ? -72.06 38.12 35 4 ASP A 35 ? ? -140.69 -15.12 36 4 GLN A 48 ? ? -93.92 -61.13 37 4 HIS A 55 ? ? -163.94 -60.21 38 4 TYR A 57 ? ? 47.17 29.10 39 4 GLN A 58 ? ? -68.84 75.25 40 4 ASN A 59 ? ? -169.54 -36.42 41 4 ASN A 67 ? ? -171.02 -179.83 42 4 PRO A 71 ? ? -71.89 41.10 43 4 ASP A 72 ? ? 49.75 77.00 44 5 LEU A 18 ? ? -72.58 28.14 45 5 LYS A 19 ? ? -148.26 -44.47 46 5 TYR A 57 ? ? -57.24 100.68 47 5 ILE A 66 ? ? -83.22 -71.84 48 5 PRO A 71 ? ? -42.98 153.34 49 5 ASP A 72 ? ? -55.69 95.23 50 5 LYS A 94 ? ? -120.01 -53.90 51 5 PHE A 108 ? ? -72.51 -80.69 52 5 PRO A 112 ? ? -67.53 -77.28 53 6 LEU A 18 ? ? -71.86 21.01 54 6 LYS A 19 ? ? -149.29 -56.64 55 6 GLN A 36 ? ? -141.57 -44.08 56 6 HIS A 55 ? ? -142.53 17.11 57 6 TYR A 57 ? ? -59.24 85.02 58 6 SER A 110 ? ? -161.83 88.02 59 6 PRO A 112 ? ? -75.08 -74.53 60 7 SER A 3 ? ? -69.66 96.51 61 7 LYS A 19 ? ? -133.91 -58.14 62 7 GLN A 36 ? ? -138.37 -44.11 63 7 ILE A 66 ? ? -92.34 -65.67 64 7 HIS A 116 ? ? -56.06 -7.87 65 7 HIS A 119 ? ? 73.87 -36.10 66 8 LEU A 18 ? ? -73.97 31.23 67 8 LYS A 19 ? ? -140.95 -51.93 68 8 TYR A 57 ? ? -53.35 86.72 69 8 ASN A 59 ? ? -171.67 -43.39 70 8 ILE A 66 ? ? -75.20 -71.60 71 8 PRO A 71 ? ? -64.54 74.77 72 8 ASP A 92 ? ? -65.91 95.06 73 9 GLN A 4 ? ? -155.42 64.37 74 9 LEU A 18 ? ? -75.33 31.15 75 9 LYS A 19 ? ? -151.56 -36.57 76 9 HIS A 55 ? ? -140.88 11.15 77 9 LYS A 56 ? ? -137.76 -157.49 78 9 TYR A 57 ? ? -67.92 86.40 79 9 ILE A 66 ? ? -124.51 -85.83 80 9 PRO A 71 ? ? -53.08 -75.16 81 9 SER A 110 ? ? -160.59 62.37 82 10 LEU A 18 ? ? -71.40 24.09 83 10 LYS A 19 ? ? -155.51 -45.91 84 10 TYR A 57 ? ? -54.55 88.92 85 10 ASN A 59 ? ? -161.47 -54.24 86 10 ILE A 66 ? ? -91.26 -85.03 87 10 PRO A 71 ? ? -50.35 79.49 88 10 ASP A 72 ? ? 50.35 79.43 89 10 SER A 110 ? ? -172.80 65.56 90 10 HIS A 116 ? ? 74.07 -51.97 91 10 HIS A 117 ? ? -49.33 109.58 92 11 ALA A 5 ? ? 178.37 170.22 93 11 ASP A 20 ? ? -91.88 -61.46 94 11 HIS A 55 ? ? -129.01 -67.86 95 11 LYS A 109 ? ? 66.22 -167.38 96 11 SER A 110 ? ? -173.55 92.64 97 11 PRO A 112 ? ? -80.28 -70.85 98 12 GLN A 4 ? ? -107.76 43.93 99 12 LEU A 18 ? ? -73.69 34.94 100 12 LYS A 19 ? ? -161.28 -36.80 101 12 HIS A 55 ? ? -146.01 15.12 102 12 TYR A 57 ? ? -69.41 83.28 103 12 ILE A 66 ? ? -96.60 -60.33 104 12 LYS A 109 ? ? -173.88 -177.77 105 12 SER A 110 ? ? -174.86 86.56 106 13 SER A 3 ? ? 69.24 -66.00 107 13 ILE A 16 ? ? -58.55 102.17 108 13 LEU A 18 ? ? -75.31 48.93 109 13 LYS A 19 ? ? -172.36 -43.00 110 13 HIS A 55 ? ? -154.61 -58.49 111 13 TYR A 57 ? ? 48.24 29.46 112 13 PRO A 71 ? ? -38.57 -78.23 113 13 ASP A 72 ? ? -94.46 32.41 114 13 ASP A 92 ? ? -63.71 91.25 115 13 LYS A 109 ? ? -161.24 91.36 116 13 PRO A 112 ? ? -58.28 -76.00 117 13 HIS A 116 ? ? -85.51 49.64 118 14 GLN A 4 ? ? -158.01 25.44 119 14 TYR A 57 ? ? 49.00 18.68 120 14 PRO A 71 ? ? -45.19 -76.76 121 14 SER A 110 ? ? -168.33 115.07 122 15 ILE A 16 ? ? -68.43 96.72 123 15 LEU A 18 ? ? -72.15 43.33 124 15 LYS A 19 ? ? -161.30 -65.16 125 15 TYR A 57 ? ? -50.00 86.06 126 15 PHE A 108 ? ? -65.70 -73.04 127 15 LYS A 109 ? ? -164.68 109.18 128 15 PRO A 112 ? ? -62.05 -76.94 129 15 HIS A 118 ? ? -172.29 80.79 130 16 LYS A 19 ? ? -146.73 -36.76 131 16 LYS A 56 ? ? -151.32 -155.46 132 16 TYR A 57 ? ? -61.75 85.08 133 16 ASN A 59 ? ? -176.04 -41.31 134 16 ASN A 67 ? ? -171.98 -176.13 135 17 LEU A 18 ? ? -73.89 35.64 136 17 LYS A 19 ? ? -149.59 -41.37 137 17 HIS A 55 ? ? -149.10 -44.42 138 17 ILE A 66 ? ? -108.19 -84.00 139 17 ASP A 72 ? ? -125.05 -71.33 140 17 LYS A 94 ? ? -104.09 -62.50 141 17 ASN A 96 ? ? 60.97 66.01 142 17 SER A 110 ? ? -168.78 91.50 143 17 GLU A 115 ? ? -84.15 -77.87 144 18 ILE A 66 ? ? -96.73 -70.07 145 18 SER A 110 ? ? -168.61 92.72 146 18 PRO A 112 ? ? -71.94 -72.69 147 19 ILE A 16 ? ? -63.01 98.32 148 19 LEU A 18 ? ? -74.14 43.47 149 19 LYS A 19 ? ? -156.03 -61.21 150 19 HIS A 55 ? ? -132.01 -50.53 151 19 TYR A 57 ? ? 48.13 29.88 152 19 ILE A 66 ? ? -105.58 -62.41 153 19 SER A 110 ? ? -170.58 87.54 154 19 HIS A 120 ? ? -135.66 -72.97 155 20 GLN A 4 ? ? -169.53 113.59 156 20 ALA A 5 ? ? -170.40 -148.02 157 20 LEU A 18 ? ? -68.19 11.05 158 20 LYS A 19 ? ? -135.01 -41.29 159 20 LYS A 56 ? ? -86.78 -147.53 160 20 TYR A 57 ? ? -51.72 88.84 161 20 ILE A 66 ? ? -96.89 -67.30 162 20 PHE A 108 ? ? -64.03 -78.88 163 20 HIS A 118 ? ? -67.06 74.28 164 20 HIS A 120 ? ? 79.02 -35.05 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KRT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.1 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.5 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'PSVS software' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2KRT _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KRT _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.91 mM [U-100% 13C; U-100% 15N] UuR17A, Lipoprotein, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.91 mM [U-100% 13C; U-100% 15N] UuR17A, Lipoprotein, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '0.7 mM [U-10% 13C; U-99% 15N] UuR17A, Lipoprotein, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'UuR17A, Lipoprotein' 0.91 ? mM '[U-100% 13C; U-100% 15N]' 1 'UuR17A, Lipoprotein' 0.91 ? mM '[U-100% 13C; U-100% 15N]' 2 'UuR17A, Lipoprotein' 0.7 ? mM '[U-10% 13C; U-99% 15N]' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '5mM CaCl2, 10mM Nacl' _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D 1H-15N/13C simultaneous NOESY' 1 4 1 '3D 1H-13C arom NOESY' 1 5 2 '2D 1H-15N HSQC' 1 6 2 '2D 1H-13C HSQC' 1 7 2 '3D CBCA(CO)NH' 1 8 2 '3D HBHA(CO)NH' 1 9 2 '3D HNCO' 1 10 2 '3D HNCA' 1 11 2 '3D HNCACB' 1 12 2 '(4,3)D GFT-CBCACACONHN' 1 13 2 '(4,3)D GFT-HNNCABCA' 1 14 2 '3D CCH-TOCSY' 1 15 2 '3D HCCH-TOCSY' 1 16 2 '3D CCCONH TOCSY' 1 17 3 '3D HNHA' 1 18 3 'Het NOE' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KRT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2045 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 388 _pdbx_nmr_constraints.NOE_long_range_total_count 625 _pdbx_nmr_constraints.NOE_medium_range_total_count 440 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 592 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 64 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 64 # _pdbx_nmr_refine.entry_id 2KRT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structure was obtained using triple resonance NMR spectroscopy. GFT_NMR experiments were used for backbone resosnance assignments and conventional 3D TOCSY experiments were used for sidechain assignments. Automated NOESY assignments were made using AUTOSTRUCTURE and CYANA-3.0 software. Dihedral angle constraints were obtained using TALOS. The structure calculation was done excluding the 8-residue C-terminal tag (LEHHHHHH). Final structure quality factor excluding C-terminal tag: as determined by PSVS-v1-4: Ordered residues are defined as 5-71, 74-114. (a) RMSD (ordered residue) all backbone atoms - 0.7A, heacyatoms - 1.1A. (b) Ramachandran statistics for ordered residues: Most favored region: 85.1%, additionally favored: 14.6%, Generously allowed: 0.4%. (c) Procheck scores for ordered residues (RAW/Z): Phi/psi - -0.42/-1.34, all - -0.40/-2.37. (d) MolProbity clashscores (RAW/Z) - 21.86/-2.23. (e) RPF scores for the goodness fit to NOESY data: Recall - 0.917, Precision - 0.928, F-measure 0.923 and final dp-score - 0.755. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 2.0.6 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 3 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE 1.0 4 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.2.1 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 500 Varian INOVA 3 'Varian INOVA' # _atom_sites.entry_id 2KRT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_