data_2KSH # _entry.id 2KSH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KSH pdb_00002ksh 10.2210/pdb2ksh/pdb RCSB RCSB101518 ? ? BMRB 16662 ? ? WWPDB D_1000101518 ? ? # _pdbx_database_related.db_id 16662 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KSH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-01-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Singarapu, N.' 1 'Radek, J.T.' 2 'Tonelli, M.' 3 'Lan, Q.' 4 'Markley, J.L.' 5 # _citation.id primary _citation.title 'Solution NMR structure of apo Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Singarapu, N.' 1 ? primary 'Radek, J.T.' 2 ? primary 'Tonelli, M.' 3 ? primary 'Lan, Q.' 4 ? primary 'Markley, J.L.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sterol carrier protein 2' _entity.formula_weight 12287.228 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALP AKEAMAQDKMEVDGQVELIFLLEPFIASLK ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALP AKEAMAQDKMEVDGQVELIFLLEPFIASLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 LYS n 1 5 SER n 1 6 ASP n 1 7 GLU n 1 8 VAL n 1 9 PHE n 1 10 ALA n 1 11 LYS n 1 12 ILE n 1 13 ALA n 1 14 LYS n 1 15 ARG n 1 16 LEU n 1 17 GLU n 1 18 SER n 1 19 ILE n 1 20 ASP n 1 21 PRO n 1 22 ALA n 1 23 ASN n 1 24 ARG n 1 25 GLN n 1 26 VAL n 1 27 GLU n 1 28 HIS n 1 29 VAL n 1 30 TYR n 1 31 LYS n 1 32 PHE n 1 33 ARG n 1 34 ILE n 1 35 THR n 1 36 GLN n 1 37 GLY n 1 38 GLY n 1 39 LYS n 1 40 VAL n 1 41 VAL n 1 42 LYS n 1 43 ASN n 1 44 TRP n 1 45 VAL n 1 46 MET n 1 47 ASP n 1 48 LEU n 1 49 LYS n 1 50 ASN n 1 51 VAL n 1 52 LYS n 1 53 LEU n 1 54 VAL n 1 55 GLU n 1 56 SER n 1 57 ASP n 1 58 ASP n 1 59 ALA n 1 60 ALA n 1 61 GLU n 1 62 ALA n 1 63 THR n 1 64 LEU n 1 65 THR n 1 66 MET n 1 67 GLU n 1 68 ASP n 1 69 ASP n 1 70 ILE n 1 71 MET n 1 72 PHE n 1 73 ALA n 1 74 ILE n 1 75 GLY n 1 76 THR n 1 77 GLY n 1 78 ALA n 1 79 LEU n 1 80 PRO n 1 81 ALA n 1 82 LYS n 1 83 GLU n 1 84 ALA n 1 85 MET n 1 86 ALA n 1 87 GLN n 1 88 ASP n 1 89 LYS n 1 90 MET n 1 91 GLU n 1 92 VAL n 1 93 ASP n 1 94 GLY n 1 95 GLN n 1 96 VAL n 1 97 GLU n 1 98 LEU n 1 99 ILE n 1 100 PHE n 1 101 LEU n 1 102 LEU n 1 103 GLU n 1 104 PRO n 1 105 PHE n 1 106 ILE n 1 107 ALA n 1 108 SER n 1 109 LEU n 1 110 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Yellowfever mosquito' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SCP-2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Aedes aegypti' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7159 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pGEX-4T-2 tag' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q86PR3_AEDAE _struct_ref.pdbx_db_accession Q86PR3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSLKSDEVFAKIAKRLESIDPANRQVEHVYKFRITQGGKVVKNWVMDLKNVKLVESDDAAEATLTMEDDIMFAIGTGALP AKEAMAQDKMEVDGQVELIFLLEPFIASLK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KSH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 110 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86PR3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 110 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 110 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCACB' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D HNCO' 1 10 2 '2D 1H-15N HSQC' 1 11 2 '2D 1H-15N TROSY' 1 12 3 '2D 1H-15N HSQC' 1 13 3 '2D 1H-15N TROSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 7.8 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '2 mM [U-100% 13C; U-100% 15N] AeSCP-2, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '1 mM [U-100% 15N] AeSCP-2, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' '1 mM [U-100% 15N] AESCP-2, 93% H2O/7% D2O, 15 mg/ml Pf1 phage' 3 '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KSH _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KSH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KSH _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'P.GUNTERT ET AL.' 'structure solution' CYANA 3.0 1 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 5 'Bhattacharya and Montelione' 'data analysis' PSVS ? 6 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 7 Varian collection VnmrJ ? 8 'Bartels et al.' 'data analysis' XEASY ? 9 'P.GUNTERT ET AL.' refinement CYANA 3.0 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KSH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KSH _struct.title 'Solution NMR structure of apo Sterol Carrier Protein - 2 from Aedes aegypti (AeSCP-2)' _struct.pdbx_model_details 'fewest violations, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KSH _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'SCP-2, LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 4 ? GLU A 17 ? LYS A 4 GLU A 17 1 ? 14 HELX_P HELX_P2 2 ASP A 68 ? THR A 76 ? ASP A 68 THR A 76 1 ? 9 HELX_P HELX_P3 3 PRO A 80 ? GLN A 87 ? PRO A 80 GLN A 87 1 ? 8 HELX_P HELX_P4 4 GLN A 95 ? LEU A 102 ? GLN A 95 LEU A 102 1 ? 8 HELX_P HELX_P5 5 GLU A 103 ? ILE A 106 ? GLU A 103 ILE A 106 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 52 ? VAL A 54 ? LYS A 52 VAL A 54 A 2 LYS A 39 ? ASP A 47 ? LYS A 39 ASP A 47 A 3 TYR A 30 ? GLN A 36 ? TYR A 30 GLN A 36 A 4 ALA A 62 ? GLU A 67 ? ALA A 62 GLU A 67 A 5 MET A 90 ? GLY A 94 ? MET A 90 GLY A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 54 ? O VAL A 54 N VAL A 45 ? N VAL A 45 A 2 3 O TRP A 44 ? O TRP A 44 N PHE A 32 ? N PHE A 32 A 3 4 N LYS A 31 ? N LYS A 31 O LEU A 64 ? O LEU A 64 A 4 5 N THR A 63 ? N THR A 63 O ASP A 93 ? O ASP A 93 # _atom_sites.entry_id 2KSH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 TRP 44 44 44 TRP TRP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 MET 71 71 71 MET MET A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLN 95 95 95 GLN GLN A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LYS 110 110 110 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-31 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id AeSCP-2-1 2 ? mM '[U-100% 13C; U-100% 15N]' 1 AeSCP-2-2 1 ? mM '[U-100% 15N]' 2 AeSCP-2-3 1 ? mM '[U-100% 15N]' 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 25 ? ? 179.55 -43.47 2 1 ALA A 78 ? ? -77.88 -73.72 3 1 LEU A 109 ? ? -174.97 117.05 4 2 ARG A 24 ? ? -179.58 106.66 5 2 ALA A 78 ? ? -69.37 -74.30 6 3 GLN A 25 ? ? -177.86 -51.05 7 3 ALA A 78 ? ? -68.58 -75.14 8 4 ARG A 24 ? ? -168.77 79.83 9 4 ALA A 78 ? ? -81.66 -74.42 10 5 ARG A 24 ? ? -178.94 140.44 11 5 ASP A 47 ? ? -61.68 -163.68 12 5 LEU A 48 ? ? -160.05 -47.48 13 6 ARG A 24 ? ? 179.80 95.83 14 6 ASP A 47 ? ? -58.06 -165.68 15 6 LEU A 48 ? ? -153.95 -52.49 16 6 LEU A 109 ? ? -67.96 90.64 17 7 ASN A 23 ? ? -160.78 114.54 18 7 ARG A 24 ? ? -162.58 19.42 19 7 GLN A 25 ? ? 59.57 -85.20 20 7 ALA A 78 ? ? -50.23 -72.22 21 8 ARG A 24 ? ? -178.81 107.20 22 8 ASP A 47 ? ? -62.66 -165.47 23 8 LEU A 48 ? ? -161.67 -40.77 24 9 ARG A 24 ? ? 179.91 129.66 25 9 GLU A 55 ? ? -66.95 98.86 26 9 ALA A 78 ? ? -72.65 -73.28 27 10 ARG A 24 ? ? -178.90 -178.09 28 10 GLN A 25 ? ? -145.97 -48.04 29 10 ALA A 78 ? ? -45.79 -74.27 30 11 ARG A 24 ? ? -168.79 -38.14 31 11 GLN A 25 ? ? 71.37 -69.33 32 11 ASP A 47 ? ? -61.20 -163.57 33 11 LEU A 48 ? ? -156.09 -48.92 34 11 ALA A 78 ? ? -73.41 -76.48 35 12 ARG A 24 ? ? -157.94 83.42 36 12 ASP A 47 ? ? -56.92 -167.89 37 12 LEU A 48 ? ? -153.30 -55.16 38 12 ALA A 59 ? ? -48.64 154.31 39 13 ARG A 24 ? ? 179.52 178.63 40 13 GLN A 25 ? ? -142.77 -74.82 41 13 ASP A 47 ? ? -59.71 -163.50 42 13 LEU A 48 ? ? -146.16 -51.70 43 13 VAL A 51 ? ? 70.04 37.21 44 13 ALA A 78 ? ? -83.29 -75.60 45 14 ARG A 24 ? ? 44.49 -164.95 46 14 GLN A 25 ? ? -139.75 -68.70 47 14 ALA A 78 ? ? -50.81 -75.54 48 14 LEU A 109 ? ? -61.18 93.81 49 15 ARG A 24 ? ? 179.64 -172.14 50 15 GLN A 25 ? ? -159.29 -44.39 51 15 ASP A 47 ? ? -61.23 -163.31 52 15 LEU A 48 ? ? -159.39 -47.99 53 15 ALA A 78 ? ? -81.09 -76.36 54 15 LEU A 109 ? ? -178.90 33.89 55 16 ARG A 24 ? ? -163.83 82.21 56 16 ASP A 47 ? ? -60.49 -163.26 57 16 LEU A 48 ? ? -153.75 -44.91 58 16 ALA A 78 ? ? -73.49 -71.21 59 17 ARG A 24 ? ? -179.82 90.38 60 17 GLN A 25 ? ? -67.87 -71.52 61 17 ALA A 78 ? ? -71.22 -70.73 62 18 ARG A 24 ? ? 179.83 161.36 63 18 GLN A 25 ? ? -129.89 -53.93 64 18 VAL A 41 ? ? -132.24 -31.23 65 18 ASP A 58 ? ? -49.55 162.89 66 19 ARG A 24 ? ? 179.39 89.59 67 20 ARG A 24 ? ? -177.58 -177.12 68 20 GLN A 25 ? ? -139.21 -52.30 69 20 ASP A 47 ? ? -63.52 -160.59 70 20 LEU A 48 ? ? -149.42 -40.76 71 20 VAL A 51 ? ? 70.16 36.14 72 20 GLU A 55 ? ? -63.96 96.67 73 20 ALA A 78 ? ? -71.88 -77.27 74 20 LEU A 109 ? ? -95.75 53.48 #