data_2KSJ # _entry.id 2KSJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KSJ RCSB RCSB101520 WWPDB D_1000101520 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KSJ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-01-05 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Park, S.' 1 'Marassi, F.' 2 'Black, D.' 3 'Opella, S.J.' 4 # _citation.id primary _citation.title 'Structure and dynamics of the membrane-bound form of Pf1 coat protein: implications of structural rearrangement for virus assembly.' _citation.journal_abbrev Biophys.J. _citation.journal_volume 99 _citation.page_first 1465 _citation.page_last 1474 _citation.year 2010 _citation.journal_id_ASTM BIOJAU _citation.country US _citation.journal_id_ISSN 0006-3495 _citation.journal_id_CSD 0030 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20816058 _citation.pdbx_database_id_DOI 10.1016/j.bpj.2010.06.009 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Park, S.H.' 1 primary 'Marassi, F.M.' 2 primary 'Black, D.' 3 primary 'Opella, S.J.' 4 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Capsid protein G8P' _entity.formula_weight 4612.393 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 37-82' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gene 8 protein, G8P, Coat protein B, Major coat protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _entity_poly.pdbx_seq_one_letter_code_can GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 ILE n 1 4 ASP n 1 5 THR n 1 6 SER n 1 7 ALA n 1 8 VAL n 1 9 GLU n 1 10 SER n 1 11 ALA n 1 12 ILE n 1 13 THR n 1 14 ASP n 1 15 GLY n 1 16 GLN n 1 17 GLY n 1 18 ASP n 1 19 MET n 1 20 LYS n 1 21 ALA n 1 22 ILE n 1 23 GLY n 1 24 GLY n 1 25 TYR n 1 26 ILE n 1 27 VAL n 1 28 GLY n 1 29 ALA n 1 30 LEU n 1 31 VAL n 1 32 ILE n 1 33 LEU n 1 34 ALA n 1 35 VAL n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 ILE n 1 40 TYR n 1 41 SER n 1 42 MET n 1 43 LEU n 1 44 ARG n 1 45 LYS n 1 46 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Bacteriophage Pf1' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene VIII _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas phage Pf1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10871 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAPSD_BPPF1 _struct_ref.pdbx_db_accession P03621 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA _struct_ref.pdbx_align_begin 37 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KSJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 46 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03621 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 82 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 46 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '1D 15N, 2D 1H-15N SLF' 2 2 2 '1D 15N' 3 3 3 '2D 1H-15N HSQC' 3 4 3 '3D HNCA' 3 5 3 '2D 1H-15N IPAP' 3 6 3 '3D 1H-15N NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 6.7 ambient ? 313 K 2 ? 6.7 ambient ? 295 K 3 ? 6.7 ambient ? 313 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '5 mM [U-98% 15N] protein, 100% H2O' 1 '100% H2O' '5 mM [U-98% 15N] protein, 100% H2O' 2 '100% H2O' '1 mM [U-95% 15N] protein, 1 mM [U-98% 13C; U-98% 15N] protein, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Bruker Avance 1 'Bruker Avance' 500 Bruker Avance 2 'Bruker Avance' 600 Bruker DRX 3 'Bruker DRX' 700 Bruker Avance 4 ? # _pdbx_nmr_refine.entry_id 2KSJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KSJ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KSJ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH ? 2 # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.crystals_number _exptl.details _exptl.entry_id _exptl.method _exptl.method_details ? ? ? ? ? ? ? 2KSJ 'SOLUTION NMR' ? ? ? ? ? ? ? ? 2KSJ 'SOLID-STATE NMR' ? # _struct.entry_id 2KSJ _struct.title ;Structure and Dynamics of the Membrane-bound form of Pf1 Coat Protein: Implications for Structural Rearrangement During Virus Assembly ; _struct.pdbx_descriptor 'Capsid protein G8P' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KSJ _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'membrane protein, Capsid protein, Host membrane, Membrane, Transmembrane, Virion, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 4 ? ASP A 14 ? ASP A 4 ASP A 14 1 ? 11 HELX_P HELX_P2 2 ALA A 21 ? ARG A 44 ? ALA A 21 ARG A 44 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KSJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-10 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 5 ? mM '[U-98% 15N]' 1 entity_1-2 5 ? mM '[U-98% 15N]' 2 entity_1-3 1 ? mM '[U-95% 15N]' 3 entity_1-4 1 ? mM '[U-98% 13C; U-98% 15N]' 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 4 _pdbx_validate_close_contact.auth_atom_id_1 HG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 SER _pdbx_validate_close_contact.auth_seq_id_1 10 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ALA _pdbx_validate_close_contact.auth_seq_id_2 11 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 14 ? ? -68.79 50.28 2 2 ASP A 14 ? ? -69.89 45.60 3 2 GLN A 16 ? ? -59.06 91.59 4 2 LYS A 45 ? ? -2.32 97.92 5 3 ILE A 3 ? ? -152.39 63.04 6 3 ASP A 14 ? ? -71.32 45.81 7 3 LYS A 45 ? ? -34.46 -92.30 8 4 ILE A 3 ? ? -158.77 79.88 9 4 ASP A 14 ? ? -53.13 73.64 10 4 GLN A 16 ? ? -62.17 76.42 11 4 ASP A 18 ? ? -101.94 -160.00 12 4 MET A 19 ? ? -44.53 88.74 13 4 LYS A 45 ? ? 38.55 -89.50 14 5 ASP A 14 ? ? -68.26 55.01 15 6 ASP A 14 ? ? -67.98 52.78 16 6 LYS A 45 ? ? 23.41 96.84 17 7 ILE A 3 ? ? -154.87 57.68 18 7 ASP A 18 ? ? -122.32 -140.19 19 7 LYS A 45 ? ? 39.83 -80.81 20 8 ASP A 14 ? ? -68.69 55.75 21 8 ASP A 18 ? ? -100.96 -157.37 22 8 LYS A 45 ? ? -42.73 95.95 23 9 ASP A 14 ? ? -73.69 38.84 24 9 MET A 19 ? ? -70.13 30.37 25 9 LYS A 45 ? ? 15.42 74.55 #