data_2KSL # _entry.id 2KSL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KSL RCSB RCSB101522 WWPDB D_1000101522 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16667 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KSL _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-01-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mobli, M.' 1 'King, G.F.' 2 # _citation.id primary _citation.title 'Weaponization of a Hormone: Convergent Recruitment of Hyperglycemic Hormone into the Venom of Arthropod Predators' _citation.journal_abbrev Structure _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2015 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26073605 _citation.pdbx_database_id_DOI 10.1016/j.str.2015.05.003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Undheim, E.A.' 1 primary 'Grimm, L.L.' 2 primary 'Low, C.F.' 3 primary 'Morgenstern, D.' 4 primary 'Herzig, V.' 5 primary 'Zobel-Thropp, P.' 6 primary 'Pineda, S.S.' 7 primary 'Habib, R.' 8 primary 'Dziemborowicz, S.' 9 primary 'Fry, B.G.' 10 primary 'Nicholson, G.M.' 11 primary 'Binford, G.J.' 12 primary 'Mobli, M.' 13 primary 'King, G.F.' 14 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description U1-agatoxin-Ta1a _entity.formula_weight 5781.391 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U1-AGTX-Ta1a, Paralytic insecticidal toxin 1, TaITX-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SEPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQK _entity_poly.pdbx_seq_one_letter_code_can SEPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 PRO n 1 4 ASP n 1 5 GLU n 1 6 ILE n 1 7 CYS n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 MET n 1 12 THR n 1 13 HIS n 1 14 LYS n 1 15 GLU n 1 16 PHE n 1 17 ASN n 1 18 TYR n 1 19 LYS n 1 20 SER n 1 21 ASN n 1 22 VAL n 1 23 CYS n 1 24 ASN n 1 25 GLY n 1 26 CYS n 1 27 GLY n 1 28 ASP n 1 29 GLN n 1 30 VAL n 1 31 ALA n 1 32 ALA n 1 33 CYS n 1 34 GLU n 1 35 ALA n 1 36 GLU n 1 37 CYS n 1 38 PHE n 1 39 ARG n 1 40 ASN n 1 41 ASP n 1 42 VAL n 1 43 TYR n 1 44 THR n 1 45 ALA n 1 46 CYS n 1 47 HIS n 1 48 GLU n 1 49 ALA n 1 50 GLN n 1 51 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Hobo spider' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ITX1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Tegenaria agrestis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 73900 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'The toxin was produced by overexpression in the periplasm of Escherichia coli.' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TXI1_TEGAG _struct_ref.pdbx_db_accession O46166 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQK _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KSL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O46166 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 67 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 51 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2KSL _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O46166 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'EXPRESSION TAG' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D CBCA(CO)NH' 1 2 1 '3D HNCACB' 1 3 1 '3D HNCO' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '4D HCC(CO)NH' 1 6 1 '2D 1H-15N HSQC' 1 7 2 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1 _pdbx_nmr_exptl_sample_conditions.pH 4.4 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '150 uM [U-100% 13C; U-100% 15N] Ta1a-1, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '150 uM [U-100% 13C; U-100% 15N] Ta1a-2, 100% D2O' 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 900 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KSL _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2KSL _pdbx_nmr_details.text 'Mixing times were 200 ms (3D NOESY) and 12 ms (4D HCC(CO)NH).' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'BEST MOLPROBITY SCORE' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KSL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KSL _pdbx_nmr_representative.selection_criteria 'best molprobity score' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'P.GUNTERT ET AL.' 'noesy assignment' CYANA 2.1 1 'P.GUNTERT ET AL.' 'structure solution' CYANA 2.1 2 'P.GUNTERT ET AL.' refinement CYANA 2.1 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Structure of the insecticidal neurotoxin TaITX-1 determined using heteronuclear NMR' _exptl.entry_id 2KSL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KSL _struct.title 'Structure of the insecticidal toxin TaITX-1' _struct.pdbx_descriptor U1-agatoxin-Ta1a _struct.pdbx_model_details 'BEST MOLPROBITY SCORE, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KSL _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text ;insecticidal toxin, spider toxin, neurotoxin, crustacean hyperglycemic hormone, molt-inhibiting hormone, Disulfide bond, Secreted, Toxin ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 4 ? MET A 11 ? ASP A 4 MET A 11 1 ? 8 HELX_P HELX_P2 2 THR A 12 ? GLY A 27 ? THR A 12 GLY A 27 1 ? 16 HELX_P HELX_P3 3 GLN A 29 ? GLU A 36 ? GLN A 29 GLU A 36 1 ? 8 HELX_P HELX_P4 4 ASN A 40 ? ALA A 49 ? ASN A 40 ALA A 49 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 7 A CYS 37 1_555 ? ? ? ? ? ? ? 2.039 ? disulf2 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 23 A CYS 33 1_555 ? ? ? ? ? ? ? 1.975 ? disulf3 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 26 A CYS 46 1_555 ? ? ? ? ? ? ? 2.013 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2KSL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LYS 51 51 51 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-10-03 4 'Structure model' 1 3 2015-06-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Ta1a-1 150 ? uM '[U-100% 13C; U-100% 15N]' 1 Ta1a-2 150 ? uM '[U-100% 13C; U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 9 _pdbx_nmr_constraints.entry_id 2KSL _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 36 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 574 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 183 _pdbx_nmr_constraints.NOE_long_range_total_count 88 _pdbx_nmr_constraints.NOE_medium_range_total_count 137 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 166 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 20 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 37 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 36 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 39 ? ? -119.71 70.89 2 2 ARG A 39 ? ? -118.58 70.84 3 3 GLU A 36 ? ? -95.86 30.24 4 3 ARG A 39 ? ? -116.97 70.27 5 4 PRO A 3 ? ? -69.72 -174.68 6 4 GLU A 36 ? ? -95.98 30.63 7 5 PRO A 3 ? ? -69.81 -176.03 8 5 GLU A 36 ? ? -99.75 33.28 9 6 ARG A 39 ? ? -119.82 70.75 10 7 ASP A 4 ? ? -98.75 44.51 11 7 GLU A 36 ? ? -97.72 33.65 12 8 ARG A 39 ? ? -118.35 70.79 13 8 GLN A 50 ? ? -54.94 174.34 14 9 ARG A 39 ? ? -115.75 70.90 15 10 ARG A 39 ? ? -117.48 68.84 16 11 PRO A 3 ? ? -69.78 -175.10 17 11 GLU A 36 ? ? -95.96 30.86 18 12 ARG A 39 ? ? -116.41 69.34 19 13 GLU A 36 ? ? -96.07 30.24 20 14 GLU A 36 ? ? -95.97 30.05 21 15 PRO A 3 ? ? -69.79 -173.29 22 15 ARG A 39 ? ? -119.57 72.08 23 16 ARG A 39 ? ? -119.83 72.07 24 17 ARG A 39 ? ? -119.18 66.16 25 18 PRO A 3 ? ? -69.71 -177.11 26 18 ARG A 39 ? ? -117.76 67.33 27 19 GLU A 36 ? ? -95.99 30.43 28 20 PRO A 3 ? ? -69.79 -175.88 29 21 ASP A 4 ? ? -98.47 34.72 30 21 ARG A 39 ? ? -117.02 66.13 31 22 ARG A 39 ? ? -119.43 72.16 32 23 ARG A 39 ? ? -119.52 70.64 33 24 ARG A 39 ? ? -116.72 72.82 #