data_2KT9 # _entry.id 2KT9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KT9 pdb_00002kt9 10.2210/pdb2kt9/pdb RCSB RCSB101545 ? ? BMRB 16691 ? 10.13018/BMR16691 WWPDB D_1000101545 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-02-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-01-29 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other 7 4 'Structure model' 'Database references' 8 4 'Structure model' Other 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_sample_details 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_database_status 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KT9 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-01-22 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16691 BMRB unspecified . SgR46 TargetDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Janjua, J.' 2 'Xiao, R.' 3 'Mao, B.' 4 'Buchwald, W.A.' 5 'Ciccosanti, C.' 6 'Belote, R.L.' 7 'Everett, J.K.' 8 'Nair, R.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title ;Solution NMR Structure of Probable 30S ribosomal protein PSRP-3 (Ycf65-like protein) from Synechocystis sp. (PCC 6803), Northeast Structural Genomics Consortium Target Target SgR46 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Janjua, J.' 2 ? primary 'Xiao, R.' 3 ? primary 'Buchwald, W.A.' 4 ? primary 'Ciccosanti, C.' 5 ? primary 'Belote, R.L.' 6 ? primary 'Everett, E.K.' 7 ? primary 'Nair, R.' 8 ? primary 'Acton, A.B.' 9 ? primary 'Rost, B.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable 30S ribosomal protein PSRP-3' _entity.formula_weight 13317.944 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 6-112' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Ycf65-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFW QDLKNQNKQISMAEAQGKFPEVVFSGSNLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFW QDLKNQNKQISMAEAQGKFPEVVFSGSNLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SgR46 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 ALA n 1 4 SER n 1 5 THR n 1 6 VAL n 1 7 HIS n 1 8 THR n 1 9 SER n 1 10 PHE n 1 11 ILE n 1 12 LEU n 1 13 LYS n 1 14 VAL n 1 15 LEU n 1 16 TRP n 1 17 LEU n 1 18 ASP n 1 19 GLN n 1 20 ASN n 1 21 VAL n 1 22 ALA n 1 23 ILE n 1 24 ALA n 1 25 VAL n 1 26 ASP n 1 27 GLN n 1 28 ILE n 1 29 VAL n 1 30 GLY n 1 31 LYS n 1 32 GLY n 1 33 THR n 1 34 SER n 1 35 PRO n 1 36 LEU n 1 37 THR n 1 38 SER n 1 39 TYR n 1 40 PHE n 1 41 PHE n 1 42 TRP n 1 43 PRO n 1 44 ARG n 1 45 ALA n 1 46 ASP n 1 47 ALA n 1 48 TRP n 1 49 GLN n 1 50 GLN n 1 51 LEU n 1 52 LYS n 1 53 ASP n 1 54 GLU n 1 55 LEU n 1 56 GLU n 1 57 ALA n 1 58 LYS n 1 59 HIS n 1 60 TRP n 1 61 ILE n 1 62 ALA n 1 63 GLU n 1 64 ALA n 1 65 ASP n 1 66 ARG n 1 67 ILE n 1 68 ASN n 1 69 VAL n 1 70 LEU n 1 71 ASN n 1 72 GLN n 1 73 ALA n 1 74 THR n 1 75 GLU n 1 76 VAL n 1 77 ILE n 1 78 ASN n 1 79 PHE n 1 80 TRP n 1 81 GLN n 1 82 ASP n 1 83 LEU n 1 84 LYS n 1 85 ASN n 1 86 GLN n 1 87 ASN n 1 88 LYS n 1 89 GLN n 1 90 ILE n 1 91 SER n 1 92 MET n 1 93 ALA n 1 94 GLU n 1 95 ALA n 1 96 GLN n 1 97 GLY n 1 98 LYS n 1 99 PHE n 1 100 PRO n 1 101 GLU n 1 102 VAL n 1 103 VAL n 1 104 PHE n 1 105 SER n 1 106 GLY n 1 107 SER n 1 108 ASN n 1 109 LEU n 1 110 GLU n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n 1 115 HIS n 1 116 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene slr0923 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 6803' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechocystis sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1148 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type 'pET 21-23C' _entity_src_gen.pdbx_host_org_vector plasmid _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PHE 99 99 99 PHE PHE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 PHE 104 104 104 PHE PHE A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 HIS 116 116 116 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KT9 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KT9 _struct.title ;Solution NMR Structure of Probable 30S Ribosomal Protein PSRP-3 (Ycf65-like protein) from Synechocystis sp. (strain PCC 6803), Northeast Structural Genomics Consortium Target Target SgR46 ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KT9 _struct_keywords.pdbx_keywords 'RIBOSOMAL PROTEIN' _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Target SgR46, PSI-2, Protein Structure Initiative, Ribonucleoprotein, Ribosomal protein, PSRP-3, YCF65-like protein ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RRP3_SYNY3 _struct_ref.pdbx_db_accession Q55385 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQ DLKNQNKQISMAEAQGKFPEVVFSGSN ; _struct_ref.pdbx_align_begin 6 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KT9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q55385 _struct_ref_seq.db_align_beg 6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KT9 MET A 1 ? UNP Q55385 ? ? 'initiating methionine' 1 1 1 2KT9 LEU A 109 ? UNP Q55385 ? ? 'expression tag' 109 2 1 2KT9 GLU A 110 ? UNP Q55385 ? ? 'expression tag' 110 3 1 2KT9 HIS A 111 ? UNP Q55385 ? ? 'expression tag' 111 4 1 2KT9 HIS A 112 ? UNP Q55385 ? ? 'expression tag' 112 5 1 2KT9 HIS A 113 ? UNP Q55385 ? ? 'expression tag' 113 6 1 2KT9 HIS A 114 ? UNP Q55385 ? ? 'expression tag' 114 7 1 2KT9 HIS A 115 ? UNP Q55385 ? ? 'expression tag' 115 8 1 2KT9 HIS A 116 ? UNP Q55385 ? ? 'expression tag' 116 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 46 ? LYS A 58 ? ASP A 46 LYS A 58 1 ? 13 HELX_P HELX_P2 2 ALA A 62 ? ASN A 87 ? ALA A 62 ASN A 87 1 ? 26 HELX_P HELX_P3 3 SER A 91 ? GLY A 97 ? SER A 91 GLY A 97 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 1 0.44 2 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 2 -1.03 3 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 3 2.23 4 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 4 -0.71 5 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 5 1.42 6 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 6 2.97 7 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 7 -2.32 8 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 8 1.04 9 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 9 -0.60 10 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 10 -4.04 11 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 11 1.01 12 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 12 -0.70 13 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 13 2.33 14 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 14 -2.57 15 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 15 -0.74 16 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 16 2.36 17 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 17 0.86 18 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 18 0.95 19 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 19 -1.43 20 TRP 42 A . ? TRP 42 A PRO 43 A ? PRO 43 A 20 -1.92 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 32 ? PRO A 35 ? GLY A 32 PRO A 35 A 2 VAL A 21 ? VAL A 29 ? VAL A 21 VAL A 29 A 3 PHE A 40 ? TRP A 42 ? PHE A 40 TRP A 42 B 1 GLY A 32 ? PRO A 35 ? GLY A 32 PRO A 35 B 2 VAL A 21 ? VAL A 29 ? VAL A 21 VAL A 29 B 3 PHE A 10 ? TRP A 16 ? PHE A 10 TRP A 16 B 4 VAL A 103 ? GLY A 106 ? VAL A 103 GLY A 106 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O SER A 34 ? O SER A 34 N GLN A 27 ? N GLN A 27 A 2 3 N VAL A 21 ? N VAL A 21 O TRP A 42 ? O TRP A 42 B 1 2 O SER A 34 ? O SER A 34 N GLN A 27 ? N GLN A 27 B 2 3 O ALA A 22 ? O ALA A 22 N LEU A 15 ? N LEU A 15 B 3 4 N LEU A 12 ? N LEU A 12 O VAL A 103 ? O VAL A 103 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -69.77 86.61 2 1 THR A 8 ? ? -66.13 88.59 3 1 SER A 107 ? ? -80.42 36.03 4 1 HIS A 114 ? ? -64.04 93.42 5 2 ALA A 3 ? ? -97.37 38.55 6 2 VAL A 6 ? ? -69.13 79.46 7 2 ASP A 46 ? ? -64.79 82.90 8 2 SER A 107 ? ? -76.64 35.82 9 2 HIS A 111 ? ? 72.82 -41.38 10 2 HIS A 112 ? ? -38.35 136.32 11 3 PRO A 35 ? ? -62.42 95.67 12 3 ASP A 46 ? ? -61.19 86.29 13 3 GLN A 89 ? ? 48.26 79.18 14 3 PHE A 99 ? ? -116.30 72.05 15 4 ASP A 46 ? ? -64.37 87.51 16 4 SER A 107 ? ? 56.88 -77.29 17 4 ASN A 108 ? ? 66.85 161.39 18 5 SER A 4 ? ? -153.96 -59.06 19 5 LEU A 17 ? ? -100.95 -169.24 20 5 ASP A 18 ? ? -71.28 -70.10 21 5 GLN A 89 ? ? 58.53 84.80 22 5 SER A 107 ? ? 58.64 83.07 23 6 ALA A 2 ? ? -78.17 -72.35 24 6 GLN A 19 ? ? -144.25 -54.59 25 6 LYS A 31 ? ? 173.94 -36.07 26 6 PRO A 35 ? ? -55.95 107.69 27 6 ASP A 46 ? ? -69.61 84.00 28 6 ASN A 108 ? ? -170.92 149.24 29 7 THR A 5 ? ? -48.15 105.33 30 7 PRO A 43 ? ? -83.23 31.45 31 7 LYS A 88 ? ? -69.71 88.03 32 7 PHE A 99 ? ? -117.40 74.78 33 7 HIS A 111 ? ? -65.72 92.57 34 8 HIS A 7 ? ? 70.85 83.60 35 8 ASN A 108 ? ? -87.47 -138.04 36 8 GLU A 110 ? ? -80.34 31.53 37 8 HIS A 113 ? ? -129.40 -58.72 38 9 THR A 5 ? ? -56.08 101.93 39 9 THR A 8 ? ? -62.60 95.16 40 9 PRO A 43 ? ? -95.63 30.11 41 9 ASP A 46 ? ? -67.73 75.95 42 9 LYS A 88 ? ? -67.20 85.20 43 10 ALA A 2 ? ? -160.00 95.64 44 10 HIS A 7 ? ? 65.73 95.80 45 10 LYS A 31 ? ? 174.43 -44.33 46 10 ARG A 44 ? ? -140.29 -38.36 47 10 ASP A 46 ? ? -69.81 81.76 48 10 PHE A 99 ? ? -115.41 78.84 49 11 ASP A 18 ? ? -59.54 98.62 50 11 ASP A 46 ? ? -69.63 79.44 51 11 PHE A 99 ? ? -112.73 77.07 52 12 ALA A 3 ? ? -164.46 -67.62 53 12 SER A 4 ? ? 54.56 -88.46 54 12 THR A 5 ? ? 60.04 112.87 55 12 VAL A 6 ? ? -65.59 78.01 56 12 ASP A 46 ? ? -65.95 81.31 57 12 PHE A 99 ? ? -119.70 72.14 58 12 HIS A 114 ? ? -69.28 97.13 59 13 ASP A 46 ? ? -64.95 82.52 60 13 SER A 107 ? ? -137.77 -158.09 61 13 LEU A 109 ? ? 55.57 -167.51 62 13 GLU A 110 ? ? -69.16 82.70 63 14 HIS A 7 ? ? -61.89 87.58 64 14 ASP A 18 ? ? -59.60 -70.81 65 14 ARG A 44 ? ? -133.44 -42.31 66 14 ASP A 46 ? ? -68.83 85.59 67 14 GLN A 89 ? ? -82.64 31.17 68 14 HIS A 112 ? ? 43.66 -168.18 69 15 HIS A 7 ? ? 59.44 82.07 70 15 PRO A 35 ? ? -58.28 107.49 71 15 ASP A 46 ? ? -66.91 84.10 72 15 ASN A 87 ? ? 56.26 70.35 73 16 SER A 107 ? ? -160.92 -95.35 74 16 ASN A 108 ? ? 172.04 147.27 75 17 SER A 4 ? ? 65.62 -72.68 76 17 PHE A 99 ? ? -117.84 78.02 77 18 ALA A 3 ? ? 68.17 -70.89 78 18 SER A 4 ? ? 48.74 -81.66 79 18 VAL A 6 ? ? -64.83 89.73 80 18 PRO A 43 ? ? -95.49 33.32 81 18 PHE A 99 ? ? -115.41 76.21 82 18 HIS A 112 ? ? -58.15 101.18 83 19 ALA A 2 ? ? 73.95 -51.40 84 19 VAL A 6 ? ? -54.54 105.40 85 19 HIS A 7 ? ? -69.17 83.38 86 19 ASP A 46 ? ? -69.13 75.90 87 19 HIS A 115 ? ? -103.80 70.32 88 20 HIS A 7 ? ? -50.41 96.35 89 20 ASP A 46 ? ? -67.35 82.30 90 20 GLU A 110 ? ? -69.04 95.12 91 20 HIS A 113 ? ? -164.83 81.10 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KT9 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KT9 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.1 mM [U-100% 13C; U-100% 15N] SgR46-1, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.8 mM [U-10% 13C; U-100% 15N] SgR46-2, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '0.3 mM [U-100% 13C; U-100% 15N] SgR46-3, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SgR46-1 1.1 ? mM '[U-100% 13C; U-100% 15N]' 1 SgR46-2 0.8 ? mM '[U-10% 13C; U-100% 15N]' 2 SgR46-3 0.3 ? mM '[U-100% 13C; U-100% 15N]' 3 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 7.5 ambient ? 293 K 2 ? 4.5 ambient ? 293 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 2 3 3 '3D HNCO' 2 4 3 '3D CBCA(CO)NH' 2 5 3 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 2 '2D 1H-13C HSQC' 2 9 3 '2D 1H-15N HSQC' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HNCA' # _pdbx_nmr_refine.entry_id 2KT9 _pdbx_nmr_refine.method 'simulated annealing, distance geometry, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 12 'Bruker Biospin' collection TopSpin ? 13 Varian collection VnmrJ ? 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2KT9 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_