data_2KUC # _entry.id 2KUC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KUC pdb_00002kuc 10.2210/pdb2kuc/pdb RCSB RCSB101582 ? ? WWPDB D_1000101582 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-03-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-11-14 4 'Structure model' 1 3 2021-02-10 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Structure summary' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 4 'Structure model' audit_author 3 4 'Structure model' citation_author 4 5 'Structure model' chem_comp_atom 5 5 'Structure model' chem_comp_bond 6 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 4 'Structure model' '_audit_author.identifier_ORCID' 3 4 'Structure model' '_citation_author.identifier_ORCID' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KUC _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-02-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id NYSGXRC-11211c _pdbx_database_related.db_name TargetDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Harris, R.' 1 ? 'Foti, R.' 2 ? 'Seidel, R.D.' 3 ? 'Bonanno, J.B.' 4 ? 'Freeman, J.' 5 ? 'Bain, K.T.' 6 ? 'Sauder, J.M.' 7 0000-0002-0254-4955 'Burley, S.K.' 8 0000-0002-2487-9713 'Girvin, M.E.' 9 ? 'Almo, S.C.' 10 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ? # _citation.id primary _citation.title 'Solution Structure of a putative disulphide-isomerase from Bacteroides thetaiotaomicron' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Foti, R.' 2 ? primary 'Seidel, R.D.' 3 ? primary 'Bonanno, J.B.' 4 ? primary 'Freeman, J.' 5 ? primary 'Bain, K.T.' 6 ? primary 'Sauder, J.M.' 7 ? primary 'Burley, S.K.' 8 0000-0002-2487-9713 primary 'Girvin, M.E.' 9 ? primary 'Almo, S.C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative disulphide-isomerase' _entity.formula_weight 14828.109 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 43-162' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRK KYGVHAYPTLLFINSSGEVVYRLVGAEDAPELLKKVKLGVESEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRK KYGVHAYPTLLFINSSGEVVYRLVGAEDAPELLKKVKLGVESEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-11211c # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 ALA n 1 5 GLN n 1 6 ALA n 1 7 ASP n 1 8 GLY n 1 9 ILE n 1 10 ALA n 1 11 PHE n 1 12 ARG n 1 13 GLU n 1 14 LEU n 1 15 SER n 1 16 PHE n 1 17 PRO n 1 18 GLU n 1 19 ALA n 1 20 LEU n 1 21 LYS n 1 22 ARG n 1 23 ALA n 1 24 GLU n 1 25 VAL n 1 26 GLU n 1 27 ASP n 1 28 LYS n 1 29 LEU n 1 30 LEU n 1 31 PHE n 1 32 VAL n 1 33 ASP n 1 34 CYS n 1 35 PHE n 1 36 THR n 1 37 THR n 1 38 TRP n 1 39 CYS n 1 40 GLY n 1 41 PRO n 1 42 CYS n 1 43 LYS n 1 44 ARG n 1 45 LEU n 1 46 SER n 1 47 LYS n 1 48 VAL n 1 49 VAL n 1 50 PHE n 1 51 LYS n 1 52 ASP n 1 53 SER n 1 54 LEU n 1 55 VAL n 1 56 ALA n 1 57 ASP n 1 58 TYR n 1 59 PHE n 1 60 ASN n 1 61 ARG n 1 62 HIS n 1 63 PHE n 1 64 VAL n 1 65 ASN n 1 66 LEU n 1 67 LYS n 1 68 MET n 1 69 ASP n 1 70 MET n 1 71 GLU n 1 72 LYS n 1 73 GLY n 1 74 GLU n 1 75 GLY n 1 76 VAL n 1 77 GLU n 1 78 LEU n 1 79 ARG n 1 80 LYS n 1 81 LYS n 1 82 TYR n 1 83 GLY n 1 84 VAL n 1 85 HIS n 1 86 ALA n 1 87 TYR n 1 88 PRO n 1 89 THR n 1 90 LEU n 1 91 LEU n 1 92 PHE n 1 93 ILE n 1 94 ASN n 1 95 SER n 1 96 SER n 1 97 GLY n 1 98 GLU n 1 99 VAL n 1 100 VAL n 1 101 TYR n 1 102 ARG n 1 103 LEU n 1 104 VAL n 1 105 GLY n 1 106 ALA n 1 107 GLU n 1 108 ASP n 1 109 ALA n 1 110 PRO n 1 111 GLU n 1 112 LEU n 1 113 LEU n 1 114 LYS n 1 115 LYS n 1 116 VAL n 1 117 LYS n 1 118 LEU n 1 119 GLY n 1 120 VAL n 1 121 GLU n 1 122 SER n 1 123 GLU n 1 124 GLY n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BT_3069 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides thetaiotaomicron' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 818 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET _entity_src_gen.pdbx_host_org_vector plasmid _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 LEU 3 0 ? ? ? A . n A 1 4 ALA 4 1 1 ALA ALA A . n A 1 5 GLN 5 2 2 GLN GLN A . n A 1 6 ALA 6 3 3 ALA ALA A . n A 1 7 ASP 7 4 4 ASP ASP A . n A 1 8 GLY 8 5 5 GLY GLY A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 PHE 11 8 8 PHE PHE A . n A 1 12 ARG 12 9 9 ARG ARG A . n A 1 13 GLU 13 10 10 GLU GLU A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 PHE 16 13 13 PHE PHE A . n A 1 17 PRO 17 14 14 PRO PRO A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 ALA 19 16 16 ALA ALA A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 ARG 22 19 19 ARG ARG A . n A 1 23 ALA 23 20 20 ALA ALA A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 VAL 25 22 22 VAL VAL A . n A 1 26 GLU 26 23 23 GLU GLU A . n A 1 27 ASP 27 24 24 ASP ASP A . n A 1 28 LYS 28 25 25 LYS LYS A . n A 1 29 LEU 29 26 26 LEU LEU A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 CYS 34 31 31 CYS CYS A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 THR 36 33 33 THR THR A . n A 1 37 THR 37 34 34 THR THR A . n A 1 38 TRP 38 35 35 TRP TRP A . n A 1 39 CYS 39 36 36 CYS CYS A . n A 1 40 GLY 40 37 37 GLY GLY A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 CYS 42 39 39 CYS CYS A . n A 1 43 LYS 43 40 40 LYS LYS A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 SER 46 43 43 SER SER A . n A 1 47 LYS 47 44 44 LYS LYS A . n A 1 48 VAL 48 45 45 VAL VAL A . n A 1 49 VAL 49 46 46 VAL VAL A . n A 1 50 PHE 50 47 47 PHE PHE A . n A 1 51 LYS 51 48 48 LYS LYS A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 SER 53 50 50 SER SER A . n A 1 54 LEU 54 51 51 LEU LEU A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 ALA 56 53 53 ALA ALA A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 TYR 58 55 55 TYR TYR A . n A 1 59 PHE 59 56 56 PHE PHE A . n A 1 60 ASN 60 57 57 ASN ASN A . n A 1 61 ARG 61 58 58 ARG ARG A . n A 1 62 HIS 62 59 59 HIS HIS A . n A 1 63 PHE 63 60 60 PHE PHE A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 ASN 65 62 62 ASN ASN A . n A 1 66 LEU 66 63 63 LEU LEU A . n A 1 67 LYS 67 64 64 LYS LYS A . n A 1 68 MET 68 65 65 MET MET A . n A 1 69 ASP 69 66 66 ASP ASP A . n A 1 70 MET 70 67 67 MET MET A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 LYS 72 69 69 LYS LYS A . n A 1 73 GLY 73 70 70 GLY GLY A . n A 1 74 GLU 74 71 71 GLU GLU A . n A 1 75 GLY 75 72 72 GLY GLY A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 ARG 79 76 76 ARG ARG A . n A 1 80 LYS 80 77 77 LYS LYS A . n A 1 81 LYS 81 78 78 LYS LYS A . n A 1 82 TYR 82 79 79 TYR TYR A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 VAL 84 81 81 VAL VAL A . n A 1 85 HIS 85 82 82 HIS HIS A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 TYR 87 84 84 TYR TYR A . n A 1 88 PRO 88 85 85 PRO PRO A . n A 1 89 THR 89 86 86 THR THR A . n A 1 90 LEU 90 87 87 LEU LEU A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 ILE 93 90 90 ILE ILE A . n A 1 94 ASN 94 91 91 ASN ASN A . n A 1 95 SER 95 92 92 SER SER A . n A 1 96 SER 96 93 93 SER SER A . n A 1 97 GLY 97 94 94 GLY GLY A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 VAL 99 96 96 VAL VAL A . n A 1 100 VAL 100 97 97 VAL VAL A . n A 1 101 TYR 101 98 98 TYR TYR A . n A 1 102 ARG 102 99 99 ARG ARG A . n A 1 103 LEU 103 100 100 LEU LEU A . n A 1 104 VAL 104 101 101 VAL VAL A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 ASP 108 105 105 ASP ASP A . n A 1 109 ALA 109 106 106 ALA ALA A . n A 1 110 PRO 110 107 107 PRO PRO A . n A 1 111 GLU 111 108 108 GLU GLU A . n A 1 112 LEU 112 109 109 LEU LEU A . n A 1 113 LEU 113 110 110 LEU LEU A . n A 1 114 LYS 114 111 111 LYS LYS A . n A 1 115 LYS 115 112 112 LYS LYS A . n A 1 116 VAL 116 113 113 VAL VAL A . n A 1 117 LYS 117 114 114 LYS LYS A . n A 1 118 LEU 118 115 115 LEU LEU A . n A 1 119 GLY 119 116 116 GLY GLY A . n A 1 120 VAL 120 117 117 VAL VAL A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 SER 122 119 119 SER SER A . n A 1 123 GLU 123 120 120 GLU GLU A . n A 1 124 GLY 124 121 121 GLY GLY A . n A 1 125 HIS 125 122 ? ? ? A . n A 1 126 HIS 126 123 ? ? ? A . n A 1 127 HIS 127 124 ? ? ? A . n A 1 128 HIS 128 125 ? ? ? A . n A 1 129 HIS 129 126 ? ? ? A . n A 1 130 HIS 130 127 ? ? ? A . n # _cell.entry_id 2KUC _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KUC _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KUC _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KUC _struct.title 'Solution Structure of a putative disulphide-isomerase from Bacteroides thetaiotaomicron' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KUC _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text ;structural genomics, putative disulphide-isomerase, thioredoxin fold, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Isomerase, NYSGXRC ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8A386_BACTN _struct_ref.pdbx_db_accession Q8A386 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LAQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKY GVHAYPTLLFINSSGEVVYRLVGAEDAPELLKKVKLGVES ; _struct_ref.pdbx_align_begin 43 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KUC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8A386 _struct_ref_seq.db_align_beg 43 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 0 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KUC MET A 1 ? UNP Q8A386 ? ? 'expression tag' -2 1 1 2KUC SER A 2 ? UNP Q8A386 ? ? 'expression tag' -1 2 1 2KUC GLU A 123 ? UNP Q8A386 ? ? 'expression tag' 120 3 1 2KUC GLY A 124 ? UNP Q8A386 ? ? 'expression tag' 121 4 1 2KUC HIS A 125 ? UNP Q8A386 ? ? 'expression tag' 122 5 1 2KUC HIS A 126 ? UNP Q8A386 ? ? 'expression tag' 123 6 1 2KUC HIS A 127 ? UNP Q8A386 ? ? 'expression tag' 124 7 1 2KUC HIS A 128 ? UNP Q8A386 ? ? 'expression tag' 125 8 1 2KUC HIS A 129 ? UNP Q8A386 ? ? 'expression tag' 126 9 1 2KUC HIS A 130 ? UNP Q8A386 ? ? 'expression tag' 127 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? ASP A 27 ? SER A 12 ASP A 24 1 ? 13 HELX_P HELX_P2 2 GLY A 40 ? VAL A 49 ? GLY A 37 VAL A 46 1 ? 10 HELX_P HELX_P3 3 ASP A 52 ? PHE A 63 ? ASP A 49 PHE A 60 1 ? 12 HELX_P HELX_P4 4 GLU A 74 ? TYR A 82 ? GLU A 71 TYR A 79 1 ? 9 HELX_P HELX_P5 5 ASP A 108 ? GLU A 121 ? ASP A 105 GLU A 118 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 64 ? MET A 68 ? VAL A 61 MET A 65 A 2 LEU A 30 ? CYS A 34 ? LEU A 27 CYS A 31 A 3 THR A 89 ? ILE A 93 ? THR A 86 ILE A 90 A 4 VAL A 99 ? VAL A 104 ? VAL A 96 VAL A 101 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 66 ? O LEU A 63 N ASP A 33 ? N ASP A 30 A 2 3 N LEU A 30 ? N LEU A 27 O ILE A 93 ? O ILE A 90 A 3 4 N LEU A 90 ? N LEU A 87 O LEU A 103 ? O LEU A 100 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH12 A ARG 9 ? ? OE1 A GLU 23 ? ? 1.57 2 2 OD1 A ASP 30 ? ? HZ3 A LYS 64 ? ? 1.52 3 5 HG1 A THR 34 ? ? OE1 A GLU 68 ? ? 1.59 4 13 OE2 A GLU 10 ? ? HZ1 A LYS 64 ? ? 1.58 5 17 OE2 A GLU 68 ? ? HH12 A ARG 76 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 4 ? ? -116.63 -167.80 2 1 ASP A 24 ? ? -174.02 -79.71 3 1 LYS A 25 ? ? 176.51 151.03 4 1 LEU A 26 ? ? 72.52 142.05 5 1 CYS A 36 ? ? 69.70 -89.31 6 1 PHE A 47 ? ? -80.68 32.50 7 1 ALA A 83 ? ? -132.21 -148.12 8 2 ASP A 24 ? ? -118.20 -148.44 9 2 LYS A 25 ? ? -126.53 -51.57 10 2 LYS A 69 ? ? 76.56 111.85 11 2 HIS A 82 ? ? -143.01 18.30 12 2 GLU A 120 ? ? -132.63 -70.19 13 3 ASP A 24 ? ? -100.38 -156.97 14 3 LYS A 25 ? ? -120.19 -90.45 15 3 CYS A 36 ? ? -121.89 -73.44 16 3 ALA A 83 ? ? -90.13 -159.39 17 4 ASP A 24 ? ? -140.23 -127.41 18 4 LEU A 26 ? ? 66.91 142.68 19 4 LYS A 48 ? ? -134.45 -44.16 20 4 LYS A 69 ? ? 73.40 160.99 21 4 HIS A 82 ? ? -136.10 -70.35 22 4 ALA A 83 ? ? -103.36 -160.15 23 4 GLU A 120 ? ? 66.26 93.96 24 5 CYS A 36 ? ? 77.30 163.58 25 5 PHE A 47 ? ? -84.65 39.08 26 5 LYS A 48 ? ? -133.82 -49.99 27 5 LYS A 69 ? ? 176.53 179.85 28 5 ALA A 103 ? ? -160.02 115.61 29 6 GLN A 2 ? ? -91.36 -99.18 30 6 ALA A 3 ? ? -149.88 20.42 31 6 ASP A 24 ? ? -128.54 -145.04 32 6 LYS A 25 ? ? -125.66 -85.47 33 6 CYS A 36 ? ? 61.50 -175.23 34 6 SER A 119 ? ? 65.21 166.81 35 6 GLU A 120 ? ? -161.72 -69.53 36 7 ALA A 3 ? ? -162.95 21.78 37 7 ASP A 24 ? ? -117.97 -138.07 38 7 THR A 34 ? ? -58.29 -9.35 39 7 LYS A 48 ? ? -134.31 -38.66 40 7 ASP A 105 ? ? -59.55 170.17 41 7 GLU A 118 ? ? 67.85 178.76 42 8 ALA A 3 ? ? -153.90 81.53 43 8 ASP A 24 ? ? 64.99 90.29 44 8 LYS A 25 ? ? -176.49 121.76 45 8 HIS A 82 ? ? -127.02 -72.07 46 8 ALA A 83 ? ? -153.76 32.22 47 8 GLU A 95 ? ? 56.84 95.99 48 8 VAL A 117 ? ? -122.57 -52.63 49 8 SER A 119 ? ? -96.49 -81.23 50 9 GLN A 2 ? ? -146.85 -86.88 51 9 ALA A 3 ? ? -154.97 30.49 52 9 ASP A 24 ? ? -110.31 -150.15 53 9 LYS A 25 ? ? -129.59 -85.37 54 9 GLU A 120 ? ? -159.48 -53.61 55 10 ASP A 24 ? ? -135.50 -132.61 56 10 LYS A 25 ? ? -151.10 -40.25 57 10 CYS A 36 ? ? 59.70 -159.12 58 10 GLU A 118 ? ? 64.17 -171.70 59 11 GLN A 2 ? ? -159.38 -58.59 60 11 ALA A 3 ? ? 55.11 72.00 61 11 ASP A 24 ? ? 55.53 76.95 62 11 TRP A 35 ? ? -66.02 83.08 63 11 CYS A 36 ? ? 70.87 -52.58 64 11 GLU A 118 ? ? 56.16 82.83 65 12 PHE A 47 ? ? -80.28 38.73 66 12 SER A 119 ? ? 65.69 98.44 67 13 ASP A 24 ? ? 56.19 71.66 68 13 TRP A 35 ? ? -76.11 -74.84 69 13 CYS A 36 ? ? -119.31 -164.04 70 13 VAL A 97 ? ? -92.08 -61.50 71 14 ASP A 24 ? ? -125.74 -143.99 72 14 THR A 34 ? ? -65.65 2.82 73 15 HIS A 82 ? ? -137.22 -91.70 74 15 ALA A 83 ? ? -174.73 22.48 75 15 ALA A 103 ? ? -160.27 118.97 76 15 GLU A 118 ? ? 70.17 108.99 77 16 ALA A 3 ? ? 69.46 90.65 78 16 ASP A 24 ? ? 55.94 70.04 79 16 PHE A 47 ? ? -91.68 32.40 80 16 LYS A 48 ? ? -129.83 -59.28 81 16 GLU A 118 ? ? 57.35 87.02 82 16 GLU A 120 ? ? -158.89 -45.97 83 18 ASP A 4 ? ? -165.07 -45.69 84 19 PHE A 47 ? ? -81.68 48.55 85 19 LYS A 48 ? ? -147.49 -38.83 86 19 VAL A 81 ? ? 53.58 103.13 87 19 GLU A 118 ? ? 66.80 116.50 88 19 SER A 119 ? ? 64.18 84.74 89 20 ASP A 24 ? ? -136.23 -149.29 90 20 LYS A 25 ? ? -129.04 -78.99 91 20 VAL A 96 ? ? 67.18 103.87 92 20 SER A 119 ? ? 74.83 111.48 # _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NYSGXRC _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KUC _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KUC _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-13C; U-15N] putative disulphide-isomerase, 150 mM sodium chloride, 20 mM sodium phosphate, 90 % H2O, 10 % D2O, 90% H2O, 10% D2O ; 1 '90% H2O/10% D2O' '1 mM [U-13C; U-15N] putative disulphide-isomerase, 150 mM sodium chloride, 20 mM sodium phosphate, 100 % D2O, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'putative disulphide-isomerase-1' 1 ? mM '[U-13C; U-15N]' 1 'sodium chloride-2' 150 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 H2O-4 90 ? % ? 1 D2O-5 10 ? % ? 1 'putative disulphide-isomerase-6' 1 ? mM '[U-13C; U-15N]' 2 'sodium chloride-7' 150 ? mM ? 2 'sodium phosphate-8' 20 ? mM ? 2 D2O-9 100 ? % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '150mM NaCl' _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C HSQC' 1 4 2 'aromatic 13C HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 'aromatic 13C NOESY-HSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KUC _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 64 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2369 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 621 _pdbx_nmr_constraints.NOE_long_range_total_count 641 _pdbx_nmr_constraints.NOE_medium_range_total_count 456 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 596 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 92 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 92 # _pdbx_nmr_refine.entry_id 2KUC _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'RECOORD scripts used - torsion angle dynamincs and refinement in a box of water refinement' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A LEU 0 ? A LEU 3 4 1 Y 1 A HIS 122 ? A HIS 125 5 1 Y 1 A HIS 123 ? A HIS 126 6 1 Y 1 A HIS 124 ? A HIS 127 7 1 Y 1 A HIS 125 ? A HIS 128 8 1 Y 1 A HIS 126 ? A HIS 129 9 1 Y 1 A HIS 127 ? A HIS 130 10 2 Y 1 A MET -2 ? A MET 1 11 2 Y 1 A SER -1 ? A SER 2 12 2 Y 1 A LEU 0 ? A LEU 3 13 2 Y 1 A HIS 122 ? A HIS 125 14 2 Y 1 A HIS 123 ? A HIS 126 15 2 Y 1 A HIS 124 ? A HIS 127 16 2 Y 1 A HIS 125 ? A HIS 128 17 2 Y 1 A HIS 126 ? A HIS 129 18 2 Y 1 A HIS 127 ? A HIS 130 19 3 Y 1 A MET -2 ? A MET 1 20 3 Y 1 A SER -1 ? A SER 2 21 3 Y 1 A LEU 0 ? A LEU 3 22 3 Y 1 A HIS 122 ? A HIS 125 23 3 Y 1 A HIS 123 ? A HIS 126 24 3 Y 1 A HIS 124 ? A HIS 127 25 3 Y 1 A HIS 125 ? A HIS 128 26 3 Y 1 A HIS 126 ? A HIS 129 27 3 Y 1 A HIS 127 ? A HIS 130 28 4 Y 1 A MET -2 ? A MET 1 29 4 Y 1 A SER -1 ? A SER 2 30 4 Y 1 A LEU 0 ? A LEU 3 31 4 Y 1 A HIS 122 ? A HIS 125 32 4 Y 1 A HIS 123 ? A HIS 126 33 4 Y 1 A HIS 124 ? A HIS 127 34 4 Y 1 A HIS 125 ? A HIS 128 35 4 Y 1 A HIS 126 ? A HIS 129 36 4 Y 1 A HIS 127 ? A HIS 130 37 5 Y 1 A MET -2 ? A MET 1 38 5 Y 1 A SER -1 ? A SER 2 39 5 Y 1 A LEU 0 ? A LEU 3 40 5 Y 1 A HIS 122 ? A HIS 125 41 5 Y 1 A HIS 123 ? A HIS 126 42 5 Y 1 A HIS 124 ? A HIS 127 43 5 Y 1 A HIS 125 ? A HIS 128 44 5 Y 1 A HIS 126 ? A HIS 129 45 5 Y 1 A HIS 127 ? A HIS 130 46 6 Y 1 A MET -2 ? A MET 1 47 6 Y 1 A SER -1 ? A SER 2 48 6 Y 1 A LEU 0 ? A LEU 3 49 6 Y 1 A HIS 122 ? A HIS 125 50 6 Y 1 A HIS 123 ? A HIS 126 51 6 Y 1 A HIS 124 ? A HIS 127 52 6 Y 1 A HIS 125 ? A HIS 128 53 6 Y 1 A HIS 126 ? A HIS 129 54 6 Y 1 A HIS 127 ? A HIS 130 55 7 Y 1 A MET -2 ? A MET 1 56 7 Y 1 A SER -1 ? A SER 2 57 7 Y 1 A LEU 0 ? A LEU 3 58 7 Y 1 A HIS 122 ? A HIS 125 59 7 Y 1 A HIS 123 ? A HIS 126 60 7 Y 1 A HIS 124 ? A HIS 127 61 7 Y 1 A HIS 125 ? A HIS 128 62 7 Y 1 A HIS 126 ? A HIS 129 63 7 Y 1 A HIS 127 ? A HIS 130 64 8 Y 1 A MET -2 ? A MET 1 65 8 Y 1 A SER -1 ? A SER 2 66 8 Y 1 A LEU 0 ? A LEU 3 67 8 Y 1 A HIS 122 ? A HIS 125 68 8 Y 1 A HIS 123 ? A HIS 126 69 8 Y 1 A HIS 124 ? A HIS 127 70 8 Y 1 A HIS 125 ? A HIS 128 71 8 Y 1 A HIS 126 ? A HIS 129 72 8 Y 1 A HIS 127 ? A HIS 130 73 9 Y 1 A MET -2 ? A MET 1 74 9 Y 1 A SER -1 ? A SER 2 75 9 Y 1 A LEU 0 ? A LEU 3 76 9 Y 1 A HIS 122 ? A HIS 125 77 9 Y 1 A HIS 123 ? A HIS 126 78 9 Y 1 A HIS 124 ? A HIS 127 79 9 Y 1 A HIS 125 ? A HIS 128 80 9 Y 1 A HIS 126 ? A HIS 129 81 9 Y 1 A HIS 127 ? A HIS 130 82 10 Y 1 A MET -2 ? A MET 1 83 10 Y 1 A SER -1 ? A SER 2 84 10 Y 1 A LEU 0 ? A LEU 3 85 10 Y 1 A HIS 122 ? A HIS 125 86 10 Y 1 A HIS 123 ? A HIS 126 87 10 Y 1 A HIS 124 ? A HIS 127 88 10 Y 1 A HIS 125 ? A HIS 128 89 10 Y 1 A HIS 126 ? A HIS 129 90 10 Y 1 A HIS 127 ? A HIS 130 91 11 Y 1 A MET -2 ? A MET 1 92 11 Y 1 A SER -1 ? A SER 2 93 11 Y 1 A LEU 0 ? A LEU 3 94 11 Y 1 A HIS 122 ? A HIS 125 95 11 Y 1 A HIS 123 ? A HIS 126 96 11 Y 1 A HIS 124 ? A HIS 127 97 11 Y 1 A HIS 125 ? A HIS 128 98 11 Y 1 A HIS 126 ? A HIS 129 99 11 Y 1 A HIS 127 ? A HIS 130 100 12 Y 1 A MET -2 ? A MET 1 101 12 Y 1 A SER -1 ? A SER 2 102 12 Y 1 A LEU 0 ? A LEU 3 103 12 Y 1 A HIS 122 ? A HIS 125 104 12 Y 1 A HIS 123 ? A HIS 126 105 12 Y 1 A HIS 124 ? A HIS 127 106 12 Y 1 A HIS 125 ? A HIS 128 107 12 Y 1 A HIS 126 ? A HIS 129 108 12 Y 1 A HIS 127 ? A HIS 130 109 13 Y 1 A MET -2 ? A MET 1 110 13 Y 1 A SER -1 ? A SER 2 111 13 Y 1 A LEU 0 ? A LEU 3 112 13 Y 1 A HIS 122 ? A HIS 125 113 13 Y 1 A HIS 123 ? A HIS 126 114 13 Y 1 A HIS 124 ? A HIS 127 115 13 Y 1 A HIS 125 ? A HIS 128 116 13 Y 1 A HIS 126 ? A HIS 129 117 13 Y 1 A HIS 127 ? A HIS 130 118 14 Y 1 A MET -2 ? A MET 1 119 14 Y 1 A SER -1 ? A SER 2 120 14 Y 1 A LEU 0 ? A LEU 3 121 14 Y 1 A HIS 122 ? A HIS 125 122 14 Y 1 A HIS 123 ? A HIS 126 123 14 Y 1 A HIS 124 ? A HIS 127 124 14 Y 1 A HIS 125 ? A HIS 128 125 14 Y 1 A HIS 126 ? A HIS 129 126 14 Y 1 A HIS 127 ? A HIS 130 127 15 Y 1 A MET -2 ? A MET 1 128 15 Y 1 A SER -1 ? A SER 2 129 15 Y 1 A LEU 0 ? A LEU 3 130 15 Y 1 A HIS 122 ? A HIS 125 131 15 Y 1 A HIS 123 ? A HIS 126 132 15 Y 1 A HIS 124 ? A HIS 127 133 15 Y 1 A HIS 125 ? A HIS 128 134 15 Y 1 A HIS 126 ? A HIS 129 135 15 Y 1 A HIS 127 ? A HIS 130 136 16 Y 1 A MET -2 ? A MET 1 137 16 Y 1 A SER -1 ? A SER 2 138 16 Y 1 A LEU 0 ? A LEU 3 139 16 Y 1 A HIS 122 ? A HIS 125 140 16 Y 1 A HIS 123 ? A HIS 126 141 16 Y 1 A HIS 124 ? A HIS 127 142 16 Y 1 A HIS 125 ? A HIS 128 143 16 Y 1 A HIS 126 ? A HIS 129 144 16 Y 1 A HIS 127 ? A HIS 130 145 17 Y 1 A MET -2 ? A MET 1 146 17 Y 1 A SER -1 ? A SER 2 147 17 Y 1 A LEU 0 ? A LEU 3 148 17 Y 1 A HIS 122 ? A HIS 125 149 17 Y 1 A HIS 123 ? A HIS 126 150 17 Y 1 A HIS 124 ? A HIS 127 151 17 Y 1 A HIS 125 ? A HIS 128 152 17 Y 1 A HIS 126 ? A HIS 129 153 17 Y 1 A HIS 127 ? A HIS 130 154 18 Y 1 A MET -2 ? A MET 1 155 18 Y 1 A SER -1 ? A SER 2 156 18 Y 1 A LEU 0 ? A LEU 3 157 18 Y 1 A HIS 122 ? A HIS 125 158 18 Y 1 A HIS 123 ? A HIS 126 159 18 Y 1 A HIS 124 ? A HIS 127 160 18 Y 1 A HIS 125 ? A HIS 128 161 18 Y 1 A HIS 126 ? A HIS 129 162 18 Y 1 A HIS 127 ? A HIS 130 163 19 Y 1 A MET -2 ? A MET 1 164 19 Y 1 A SER -1 ? A SER 2 165 19 Y 1 A LEU 0 ? A LEU 3 166 19 Y 1 A HIS 122 ? A HIS 125 167 19 Y 1 A HIS 123 ? A HIS 126 168 19 Y 1 A HIS 124 ? A HIS 127 169 19 Y 1 A HIS 125 ? A HIS 128 170 19 Y 1 A HIS 126 ? A HIS 129 171 19 Y 1 A HIS 127 ? A HIS 130 172 20 Y 1 A MET -2 ? A MET 1 173 20 Y 1 A SER -1 ? A SER 2 174 20 Y 1 A LEU 0 ? A LEU 3 175 20 Y 1 A HIS 122 ? A HIS 125 176 20 Y 1 A HIS 123 ? A HIS 126 177 20 Y 1 A HIS 124 ? A HIS 127 178 20 Y 1 A HIS 125 ? A HIS 128 179 20 Y 1 A HIS 126 ? A HIS 129 180 20 Y 1 A HIS 127 ? A HIS 130 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian Inova' # _atom_sites.entry_id 2KUC _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_