data_2KV3 # _entry.id 2KV3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KV3 pdb_00002kv3 10.2210/pdb2kv3/pdb RCSB RCSB101609 ? ? WWPDB D_1000101609 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-12-18 4 'Structure model' 1 3 2021-11-10 5 'Structure model' 1 4 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_ref_seq_dif 8 4 'Structure model' database_2 9 4 'Structure model' struct_ref_seq_dif 10 5 'Structure model' chem_comp_atom 11 5 'Structure model' chem_comp_bond 12 5 'Structure model' pdbx_entry_details 13 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_citation.page_first' 3 3 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.pdbx_database_id_PubMed' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation_author.name' 7 3 'Structure model' '_pdbx_nmr_software.name' 8 3 'Structure model' '_pdbx_nmr_spectrometer.model' 9 3 'Structure model' '_struct_ref_seq_dif.details' 10 4 'Structure model' '_database_2.pdbx_DOI' 11 4 'Structure model' '_database_2.pdbx_database_accession' 12 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KV3 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-03-04 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16767 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ho, M.' 1 'Lou, Y.' 2 'Chen, C.' 3 # _citation.id primary _citation.title 'Human RegIV protein adopts a typical C-type lectin fold but binds mannan with two calcium-independent sites.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 402 _citation.page_first 682 _citation.page_last 695 _citation.year 2010 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 1089-8638 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20692269 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2010.07.061 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ho, M.R.' 1 ? primary 'Lou, Y.C.' 2 ? primary 'Wei, S.Y.' 3 ? primary 'Luo, S.C.' 4 ? primary 'Lin, W.C.' 5 ? primary 'Lyu, P.C.' 6 ? primary 'Chen, C.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Regenerating islet-derived protein 4' _entity.formula_weight 15326.128 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation P91S _entity.pdbx_fragment 'UNP residues 28-158' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Regenerating Gene Type IV, REG-4, Regenerating islet-derived protein IV, Reg IV, REG-like protein, Gastrointestinal secretory protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQSIWIGLHDPQKRQQWQW IDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP ; _entity_poly.pdbx_seq_one_letter_code_can ;QSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQSIWIGLHDPQKRQQWQW IDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 SER n 1 3 CYS n 1 4 ALA n 1 5 PRO n 1 6 GLY n 1 7 TRP n 1 8 PHE n 1 9 TYR n 1 10 HIS n 1 11 LYS n 1 12 SER n 1 13 ASN n 1 14 CYS n 1 15 TYR n 1 16 GLY n 1 17 TYR n 1 18 PHE n 1 19 ARG n 1 20 LYS n 1 21 LEU n 1 22 ARG n 1 23 ASN n 1 24 TRP n 1 25 SER n 1 26 ASP n 1 27 ALA n 1 28 GLU n 1 29 LEU n 1 30 GLU n 1 31 CYS n 1 32 GLN n 1 33 SER n 1 34 TYR n 1 35 GLY n 1 36 ASN n 1 37 GLY n 1 38 ALA n 1 39 HIS n 1 40 LEU n 1 41 ALA n 1 42 SER n 1 43 ILE n 1 44 LEU n 1 45 SER n 1 46 LEU n 1 47 LYS n 1 48 GLU n 1 49 ALA n 1 50 SER n 1 51 THR n 1 52 ILE n 1 53 ALA n 1 54 GLU n 1 55 TYR n 1 56 ILE n 1 57 SER n 1 58 GLY n 1 59 TYR n 1 60 GLN n 1 61 ARG n 1 62 SER n 1 63 GLN n 1 64 SER n 1 65 ILE n 1 66 TRP n 1 67 ILE n 1 68 GLY n 1 69 LEU n 1 70 HIS n 1 71 ASP n 1 72 PRO n 1 73 GLN n 1 74 LYS n 1 75 ARG n 1 76 GLN n 1 77 GLN n 1 78 TRP n 1 79 GLN n 1 80 TRP n 1 81 ILE n 1 82 ASP n 1 83 GLY n 1 84 ALA n 1 85 MET n 1 86 TYR n 1 87 LEU n 1 88 TYR n 1 89 ARG n 1 90 SER n 1 91 TRP n 1 92 SER n 1 93 GLY n 1 94 LYS n 1 95 SER n 1 96 MET n 1 97 GLY n 1 98 GLY n 1 99 ASN n 1 100 LYS n 1 101 HIS n 1 102 CYS n 1 103 ALA n 1 104 GLU n 1 105 MET n 1 106 SER n 1 107 SER n 1 108 ASN n 1 109 ASN n 1 110 ASN n 1 111 PHE n 1 112 LEU n 1 113 THR n 1 114 TRP n 1 115 SER n 1 116 SER n 1 117 ASN n 1 118 GLU n 1 119 CYS n 1 120 ASN n 1 121 LYS n 1 122 ARG n 1 123 GLN n 1 124 HIS n 1 125 PHE n 1 126 LEU n 1 127 CYS n 1 128 LYS n 1 129 TYR n 1 130 ARG n 1 131 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene REG4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'M15(pREP4)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 TRP 7 7 7 TRP TRP A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 CYS 14 14 14 CYS CYS A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 TRP 24 24 24 TRP TRP A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 TRP 80 80 80 TRP TRP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 MET 96 96 96 MET MET A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 CYS 102 102 102 CYS CYS A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 MET 105 105 105 MET MET A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 TRP 114 114 114 TRP TRP A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 PRO 131 131 131 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KV3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KV3 _struct.title 'Human Regenerating Gene Type IV (REG IV) PROTEIN, P91S mutant' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KV3 _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'GISP, C-type lectin, Reg IV, Reg 4, Disulfide bond, Glycoprotein, Lectin, Secreted, SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code REG4_HUMAN _struct_ref.pdbx_db_accession Q9BYZ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWI DGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP ; _struct_ref.pdbx_align_begin 29 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KV3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BYZ8 _struct_ref_seq.db_align_beg 29 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 158 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KV3 GLN A 1 ? UNP Q9BYZ8 ? ? 'expression tag' 1 1 1 2KV3 SER A 64 ? UNP Q9BYZ8 PRO 91 'engineered mutation' 64 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 23 ? SER A 33 ? ASN A 23 SER A 33 1 ? 11 HELX_P HELX_P2 2 SER A 45 ? SER A 57 ? SER A 45 SER A 57 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 14 SG ? ? A CYS 3 A CYS 14 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 127 SG ? ? A CYS 31 A CYS 127 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf3 disulf ? ? A CYS 102 SG ? ? ? 1_555 A CYS 119 SG ? ? A CYS 102 A CYS 119 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 14 ? CYS A 3 ? 1_555 CYS A 14 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 31 ? CYS A 127 ? CYS A 31 ? 1_555 CYS A 127 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 102 ? CYS A 119 ? CYS A 102 ? 1_555 CYS A 119 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 9 ? HIS A 10 ? TYR A 9 HIS A 10 A 2 ASN A 13 ? ARG A 22 ? ASN A 13 ARG A 22 A 3 GLN A 123 ? TYR A 129 ? GLN A 123 TYR A 129 A 4 HIS A 39 ? LEU A 40 ? HIS A 39 LEU A 40 B 1 LEU A 69 ? HIS A 70 ? LEU A 69 HIS A 70 B 2 GLN A 79 ? TRP A 80 ? GLN A 79 TRP A 80 C 1 CYS A 102 ? MET A 105 ? CYS A 102 MET A 105 C 2 TRP A 114 ? ASN A 117 ? TRP A 114 ASN A 117 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 10 ? N HIS A 10 O ASN A 13 ? O ASN A 13 A 2 3 N ARG A 22 ? N ARG A 22 O GLN A 123 ? O GLN A 123 A 3 4 O LYS A 128 ? O LYS A 128 N HIS A 39 ? N HIS A 39 B 1 2 N HIS A 70 ? N HIS A 70 O GLN A 79 ? O GLN A 79 C 1 2 N GLU A 104 ? N GLU A 104 O SER A 115 ? O SER A 115 # _pdbx_entry_details.entry_id 2KV3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 8 HH22 A ARG 89 ? ? HZ3 A LYS 94 ? ? 1.29 2 9 HD1 A HIS 70 ? ? H A ASP 71 ? ? 1.30 3 10 HE2 A HIS 10 ? ? HZ2 A LYS 11 ? ? 1.28 4 11 HG A SER 57 ? ? H A TYR 59 ? ? 1.32 5 12 HZ1 A LYS 94 ? ? H A TRP 114 ? ? 1.28 6 13 HE1 A TRP 78 ? ? HH21 A ARG 89 ? ? 1.27 7 18 HG A SER 64 ? ? H A SER 107 ? ? 1.28 8 18 HD1 A HIS 70 ? ? H A ASP 71 ? ? 1.32 9 19 HG A SER 57 ? ? H A TYR 59 ? ? 1.25 10 20 HZ1 A LYS 11 ? ? HD22 A ASN 13 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -178.74 -51.22 2 1 PRO A 5 ? ? -45.90 84.88 3 1 SER A 12 ? ? 59.50 6.09 4 1 ARG A 19 ? ? -92.19 58.83 5 1 ALA A 41 ? ? -37.32 125.48 6 1 ARG A 61 ? ? -162.94 67.62 7 1 PRO A 72 ? ? -68.15 -89.76 8 1 ASP A 82 ? ? -62.62 1.36 9 1 TYR A 88 ? ? 51.12 90.64 10 1 SER A 92 ? ? -165.71 111.25 11 1 ASN A 99 ? ? 59.99 -0.66 12 1 LYS A 100 ? ? 35.24 -123.21 13 1 CYS A 119 ? ? -72.74 37.54 14 2 SER A 2 ? ? -167.56 -59.89 15 2 CYS A 3 ? ? 51.33 94.46 16 2 ALA A 4 ? ? -179.98 -50.51 17 2 GLN A 32 ? ? -49.94 -11.49 18 2 ALA A 41 ? ? -39.00 140.84 19 2 SER A 57 ? ? -36.62 -27.81 20 2 ARG A 61 ? ? 78.69 45.68 21 2 PRO A 72 ? ? -70.43 -93.84 22 2 ASP A 82 ? ? -61.24 0.24 23 2 TYR A 88 ? ? 46.56 84.90 24 2 SER A 92 ? ? -166.86 111.16 25 2 MET A 96 ? ? -157.97 -38.03 26 2 ASN A 99 ? ? 56.70 0.07 27 2 LYS A 100 ? ? 37.74 -116.31 28 2 CYS A 119 ? ? -73.15 34.21 29 3 CYS A 3 ? ? 49.56 81.90 30 3 ALA A 4 ? ? -179.77 -50.96 31 3 SER A 57 ? ? -39.55 -24.31 32 3 ARG A 61 ? ? 78.82 44.38 33 3 PRO A 72 ? ? -65.49 -79.54 34 3 GLN A 73 ? ? -148.58 46.23 35 3 LYS A 74 ? ? 75.04 38.35 36 3 ASP A 82 ? ? -58.81 0.46 37 3 TYR A 88 ? ? 49.66 98.79 38 3 SER A 92 ? ? -166.05 109.85 39 3 ASN A 99 ? ? -155.25 23.50 40 3 LYS A 100 ? ? 35.46 -112.45 41 3 LYS A 121 ? ? -59.12 108.89 42 4 CYS A 3 ? ? -159.91 79.56 43 4 ALA A 4 ? ? -179.97 -50.46 44 4 PRO A 5 ? ? -48.49 -17.26 45 4 GLN A 32 ? ? -49.85 -11.77 46 4 ALA A 41 ? ? -36.92 130.81 47 4 ARG A 61 ? ? 74.66 46.02 48 4 PRO A 72 ? ? -71.34 -95.10 49 4 ASP A 82 ? ? -64.15 5.96 50 4 TYR A 88 ? ? 54.29 85.47 51 4 SER A 92 ? ? -165.45 111.11 52 4 MET A 96 ? ? -48.16 -15.04 53 4 ASN A 99 ? ? 55.26 3.28 54 4 LYS A 100 ? ? 36.10 -127.98 55 4 ASN A 110 ? ? -49.06 -16.96 56 4 CYS A 119 ? ? -78.30 30.77 57 5 CYS A 3 ? ? -171.48 92.86 58 5 ALA A 4 ? ? 172.12 -64.61 59 5 PRO A 5 ? ? -61.71 93.21 60 5 GLN A 32 ? ? -49.84 -11.87 61 5 TYR A 59 ? ? -51.04 -5.73 62 5 ARG A 61 ? ? -175.46 -23.57 63 5 PRO A 72 ? ? -68.26 -91.93 64 5 ASP A 82 ? ? -61.74 4.30 65 5 TYR A 88 ? ? 58.51 83.44 66 5 SER A 92 ? ? -165.89 110.84 67 5 MET A 96 ? ? -156.60 -43.91 68 5 ASN A 99 ? ? 64.04 -6.91 69 5 LYS A 100 ? ? 42.42 -121.91 70 5 CYS A 119 ? ? -72.64 39.03 71 5 HIS A 124 ? ? -49.18 167.50 72 6 CYS A 3 ? ? -159.92 69.86 73 6 ALA A 4 ? ? -160.47 -64.69 74 6 PRO A 5 ? ? -61.98 88.29 75 6 CYS A 31 ? ? -93.29 -66.03 76 6 ALA A 41 ? ? -35.65 157.28 77 6 ARG A 61 ? ? -162.14 70.41 78 6 PRO A 72 ? ? -70.58 -93.20 79 6 ASP A 82 ? ? -61.67 0.65 80 6 TYR A 88 ? ? 52.31 80.55 81 6 SER A 92 ? ? -165.67 111.02 82 6 MET A 96 ? ? -171.88 -52.47 83 6 ASN A 99 ? ? 43.56 18.29 84 6 LYS A 100 ? ? 39.59 -130.01 85 6 CYS A 119 ? ? -75.19 37.58 86 6 ASN A 120 ? ? -141.94 13.16 87 7 CYS A 3 ? ? -164.01 80.59 88 7 ALA A 4 ? ? -176.63 -63.58 89 7 PRO A 5 ? ? -64.80 31.64 90 7 ARG A 19 ? ? -99.44 59.26 91 7 ALA A 41 ? ? -32.79 151.97 92 7 SER A 57 ? ? -38.99 -24.72 93 7 ARG A 61 ? ? 70.49 47.50 94 7 PRO A 72 ? ? -70.77 -95.07 95 7 ASP A 82 ? ? -64.18 3.44 96 7 TYR A 88 ? ? 59.55 80.68 97 7 SER A 92 ? ? -166.03 111.55 98 7 ASN A 99 ? ? 54.40 3.84 99 7 LYS A 100 ? ? 34.32 -125.02 100 7 CYS A 119 ? ? -77.28 31.49 101 8 CYS A 3 ? ? 49.45 72.54 102 8 ALA A 4 ? ? -168.71 -63.86 103 8 PRO A 5 ? ? -64.46 31.30 104 8 GLN A 32 ? ? -49.92 -11.42 105 8 TYR A 59 ? ? -51.54 -6.18 106 8 ARG A 61 ? ? -175.86 -21.45 107 8 PRO A 72 ? ? -70.89 -96.04 108 8 ASP A 82 ? ? -61.06 2.40 109 8 SER A 92 ? ? -166.06 109.19 110 8 MET A 96 ? ? -157.13 -17.45 111 8 ASN A 99 ? ? 52.62 4.21 112 8 LYS A 100 ? ? 36.90 -127.54 113 8 CYS A 119 ? ? -79.06 21.61 114 9 CYS A 3 ? ? -172.92 14.84 115 9 ALA A 4 ? ? -156.85 -64.60 116 9 PRO A 5 ? ? -61.50 80.39 117 9 ALA A 41 ? ? -42.77 158.78 118 9 SER A 57 ? ? -37.83 -28.55 119 9 TYR A 59 ? ? -53.75 -5.90 120 9 ARG A 61 ? ? 179.93 -30.99 121 9 SER A 64 ? ? 75.97 124.74 122 9 PRO A 72 ? ? -67.27 -89.44 123 9 LYS A 74 ? ? 73.51 39.47 124 9 ASP A 82 ? ? -64.83 6.13 125 9 TYR A 88 ? ? 45.30 90.15 126 9 SER A 92 ? ? -165.76 110.76 127 9 ASN A 99 ? ? 56.10 -2.23 128 9 LYS A 100 ? ? 39.77 -132.20 129 9 CYS A 119 ? ? -74.68 38.20 130 9 ASN A 120 ? ? -141.18 15.00 131 10 CYS A 3 ? ? 39.43 95.59 132 10 ALA A 4 ? ? -168.83 -49.65 133 10 PRO A 5 ? ? -53.57 92.46 134 10 GLN A 32 ? ? -49.99 -12.08 135 10 SER A 57 ? ? -39.77 -23.56 136 10 ARG A 61 ? ? 77.09 45.67 137 10 PRO A 72 ? ? -69.31 -89.24 138 10 ASP A 82 ? ? -58.98 0.95 139 10 TYR A 88 ? ? 59.20 84.41 140 10 SER A 92 ? ? -164.77 110.89 141 10 ASN A 99 ? ? 56.95 2.71 142 10 LYS A 100 ? ? 37.36 -121.03 143 10 CYS A 119 ? ? -72.86 38.10 144 11 CYS A 3 ? ? -154.20 85.82 145 11 ALA A 4 ? ? -174.14 -43.24 146 11 PRO A 5 ? ? -66.55 49.42 147 11 ARG A 19 ? ? -96.20 59.32 148 11 GLN A 32 ? ? -49.67 -11.96 149 11 ALA A 41 ? ? -40.35 154.52 150 11 TYR A 59 ? ? -51.20 -4.77 151 11 ARG A 61 ? ? -175.74 -25.47 152 11 PRO A 72 ? ? -70.22 -93.06 153 11 ASP A 82 ? ? -62.02 1.68 154 11 TYR A 88 ? ? 44.96 87.42 155 11 SER A 92 ? ? -165.75 110.91 156 11 ASN A 99 ? ? 54.92 -0.99 157 11 LYS A 100 ? ? 41.47 -124.42 158 11 CYS A 119 ? ? -76.01 36.10 159 12 CYS A 3 ? ? -170.86 79.76 160 12 ALA A 4 ? ? 179.41 -50.53 161 12 PRO A 5 ? ? -47.74 -10.99 162 12 ALA A 41 ? ? -39.33 157.18 163 12 SER A 57 ? ? -38.90 -24.14 164 12 ARG A 61 ? ? 77.79 45.86 165 12 PRO A 72 ? ? -70.09 -92.30 166 12 ASP A 82 ? ? -62.77 1.73 167 12 TYR A 88 ? ? 57.79 92.72 168 12 SER A 92 ? ? -161.00 110.96 169 12 ASN A 99 ? ? 53.55 4.46 170 12 LYS A 100 ? ? 35.85 -128.04 171 12 LYS A 121 ? ? -69.19 95.04 172 13 ALA A 4 ? ? 177.52 -64.70 173 13 PRO A 5 ? ? -62.68 88.97 174 13 CYS A 31 ? ? -93.54 -66.17 175 13 ALA A 41 ? ? -44.07 158.15 176 13 TYR A 59 ? ? -54.23 -6.08 177 13 ARG A 61 ? ? -173.68 -29.99 178 13 SER A 64 ? ? 71.72 127.44 179 13 PRO A 72 ? ? -69.38 -95.22 180 13 ASP A 82 ? ? -59.78 0.92 181 13 SER A 92 ? ? -164.33 110.94 182 13 ASN A 99 ? ? 48.48 10.59 183 13 LYS A 100 ? ? 34.93 -121.51 184 13 CYS A 119 ? ? -70.49 37.93 185 14 CYS A 3 ? ? -163.23 77.87 186 14 ALA A 4 ? ? -166.65 -63.64 187 14 PRO A 5 ? ? -65.55 62.21 188 14 ARG A 19 ? ? -95.86 59.59 189 14 GLN A 32 ? ? -49.74 -12.13 190 14 TYR A 59 ? ? -55.76 -5.84 191 14 ARG A 61 ? ? 153.75 -39.11 192 14 SER A 64 ? ? 59.22 124.59 193 14 PRO A 72 ? ? -71.05 -92.68 194 14 ASP A 82 ? ? -62.92 3.99 195 14 TYR A 88 ? ? 55.59 89.12 196 14 SER A 92 ? ? -165.60 110.74 197 14 MET A 96 ? ? -59.94 -1.55 198 14 ASN A 99 ? ? 57.75 0.55 199 14 LYS A 100 ? ? 36.94 -124.92 200 14 CYS A 119 ? ? -72.44 29.55 201 15 ALA A 4 ? ? -178.23 -64.58 202 15 PRO A 5 ? ? -62.08 89.75 203 15 ALA A 41 ? ? -38.47 155.88 204 15 SER A 57 ? ? -41.59 -17.85 205 15 ARG A 61 ? ? 76.85 45.63 206 15 PRO A 72 ? ? -68.18 -90.27 207 15 ASP A 82 ? ? -59.73 0.72 208 15 TYR A 88 ? ? 51.38 97.66 209 15 SER A 92 ? ? -165.65 110.79 210 15 MET A 96 ? ? -157.22 -45.00 211 15 ASN A 99 ? ? -150.41 19.11 212 15 LYS A 100 ? ? 35.40 -126.54 213 15 CYS A 119 ? ? -71.74 29.70 214 16 ALA A 4 ? ? -173.27 -39.59 215 16 PRO A 5 ? ? -62.61 14.65 216 16 ALA A 41 ? ? -39.13 124.58 217 16 TYR A 59 ? ? -50.82 -6.11 218 16 ARG A 61 ? ? -174.91 -25.09 219 16 PRO A 72 ? ? -67.24 -91.77 220 16 ASP A 82 ? ? -62.93 5.29 221 16 TYR A 88 ? ? 57.21 83.00 222 16 SER A 92 ? ? -162.74 110.86 223 16 ASN A 99 ? ? 54.33 4.87 224 16 LYS A 100 ? ? 40.71 -121.26 225 16 CYS A 119 ? ? -76.36 33.97 226 17 CYS A 3 ? ? -157.45 82.18 227 17 ALA A 4 ? ? -176.98 -47.16 228 17 PRO A 5 ? ? -55.69 69.30 229 17 CYS A 31 ? ? -91.61 -65.38 230 17 ALA A 41 ? ? -38.35 161.10 231 17 SER A 57 ? ? -38.97 -26.03 232 17 ARG A 61 ? ? 75.56 46.13 233 17 PRO A 72 ? ? -66.38 -89.71 234 17 LYS A 74 ? ? 71.76 39.37 235 17 ASP A 82 ? ? -61.37 0.99 236 17 SER A 92 ? ? -162.65 111.01 237 17 LYS A 100 ? ? 37.61 -122.28 238 17 CYS A 119 ? ? -72.49 38.77 239 18 SER A 2 ? ? -171.20 -61.69 240 18 CYS A 3 ? ? 52.21 75.40 241 18 ALA A 4 ? ? 178.89 -64.27 242 18 PRO A 5 ? ? -60.92 62.67 243 18 ARG A 19 ? ? -92.89 58.81 244 18 TYR A 59 ? ? -51.12 -5.81 245 18 ARG A 61 ? ? -176.02 -24.33 246 18 PRO A 72 ? ? -69.63 -92.76 247 18 ASP A 82 ? ? -61.00 3.80 248 18 TYR A 88 ? ? 47.09 88.12 249 18 SER A 92 ? ? -165.72 111.24 250 18 MET A 96 ? ? -149.99 -31.44 251 18 ASN A 99 ? ? 56.02 -5.39 252 18 LYS A 100 ? ? 42.73 -125.53 253 18 CYS A 119 ? ? -72.46 38.15 254 19 CYS A 3 ? ? -172.09 72.89 255 19 ALA A 4 ? ? -179.15 -50.48 256 19 PRO A 5 ? ? -48.38 -15.00 257 19 ALA A 41 ? ? -39.45 159.92 258 19 TYR A 59 ? ? -50.89 -4.25 259 19 ARG A 61 ? ? -170.40 -18.26 260 19 PRO A 72 ? ? -66.00 -89.65 261 19 ASP A 82 ? ? -62.97 2.30 262 19 TYR A 88 ? ? 54.33 91.82 263 19 SER A 92 ? ? -165.26 111.27 264 19 ASN A 99 ? ? 47.58 13.65 265 19 LYS A 100 ? ? 36.74 -128.14 266 19 ASN A 110 ? ? -49.42 -17.68 267 19 CYS A 119 ? ? -77.80 32.01 268 20 SER A 2 ? ? -73.95 -166.35 269 20 CYS A 3 ? ? -158.64 80.92 270 20 ALA A 4 ? ? -179.04 -49.76 271 20 PRO A 5 ? ? -50.10 80.17 272 20 SER A 12 ? ? 59.68 6.09 273 20 CYS A 31 ? ? -91.55 -66.57 274 20 ALA A 41 ? ? -37.19 144.48 275 20 TYR A 59 ? ? -53.25 -5.99 276 20 ARG A 61 ? ? -172.45 -30.82 277 20 SER A 64 ? ? 59.27 128.93 278 20 PRO A 72 ? ? -70.56 -97.12 279 20 ASP A 82 ? ? -58.76 -1.88 280 20 SER A 92 ? ? -165.89 109.09 281 20 MET A 96 ? ? -154.85 -35.12 282 20 ASN A 99 ? ? 57.92 -13.86 283 20 LYS A 100 ? ? 43.01 -130.52 284 20 CYS A 119 ? ? -74.19 38.60 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KV3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KV3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1 mM [U-99% 15N] Human Regenerating Gene Type IV-1, 1 mM [U-99% 13C; U-99% 15N] Human Regenerating Gene Type IV-2, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Human Regenerating Gene Type IV-1' 1 ? mM '[U-99% 15N]' 1 'Human Regenerating Gene Type IV-2' 1 ? mM '[U-99% 13C; U-99% 15N]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2KV3 _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2KV3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_