data_2KVO # _entry.id 2KVO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KVO RCSB RCSB101630 WWPDB D_1000101630 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id SgR171 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KVO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-03-22 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yang, Y.' 1 'Ramelot, T.A.' 2 'Cort, J.R.' 3 'Wang, D.' 4 'Ciccosanti, C.' 5 'Hamilton, K.' 6 'Nair, R.' 7 'Rost, B.' 8 'Acton, T.B.' 9 'Xiao, R.' 10 'Everett, J.K.' 11 'Montelione, G.T.' 12 'Kennedy, M.A.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. Strain PCC 6803.' _citation.journal_abbrev Proteins _citation.journal_volume 79 _citation.page_first 340 _citation.page_last 344 _citation.year 2011 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21058299 _citation.pdbx_database_id_DOI 10.1002/prot.22876 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yang, Y.' 1 primary 'Ramelot, T.A.' 2 primary 'Cort, J.R.' 3 primary 'Wang, D.' 4 primary 'Ciccosanti, C.' 5 primary 'Hamilton, K.' 6 primary 'Nair, R.' 7 primary 'Rost, B.' 8 primary 'Acton, T.B.' 9 primary 'Xiao, R.' 10 primary 'Everett, J.K.' 11 primary 'Montelione, G.T.' 12 primary 'Kennedy, M.A.' 13 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Photosystem II reaction center psb28 protein' _entity.formula_weight 13675.436 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Photosystem II reaction center W protein, Photosystem II 13 kDa protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEA TVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEA TVILNSQPEWDRFMRFMERYGAENGLGFSKSELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SgR171 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLU n 1 4 ILE n 1 5 GLN n 1 6 PHE n 1 7 SER n 1 8 LYS n 1 9 GLY n 1 10 VAL n 1 11 ALA n 1 12 GLU n 1 13 THR n 1 14 VAL n 1 15 VAL n 1 16 PRO n 1 17 GLU n 1 18 VAL n 1 19 ARG n 1 20 LEU n 1 21 SER n 1 22 LYS n 1 23 SER n 1 24 LYS n 1 25 ASN n 1 26 GLY n 1 27 GLN n 1 28 SER n 1 29 GLY n 1 30 MET n 1 31 ALA n 1 32 LYS n 1 33 PHE n 1 34 TYR n 1 35 PHE n 1 36 LEU n 1 37 GLU n 1 38 PRO n 1 39 THR n 1 40 ILE n 1 41 LEU n 1 42 ALA n 1 43 LYS n 1 44 GLU n 1 45 SER n 1 46 THR n 1 47 ASP n 1 48 ASP n 1 49 ILE n 1 50 THR n 1 51 GLY n 1 52 MET n 1 53 TYR n 1 54 LEU n 1 55 ILE n 1 56 ASP n 1 57 ASP n 1 58 GLU n 1 59 GLY n 1 60 GLU n 1 61 ILE n 1 62 ILE n 1 63 THR n 1 64 ARG n 1 65 GLU n 1 66 VAL n 1 67 LYS n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ILE n 1 72 ASN n 1 73 GLY n 1 74 ARG n 1 75 PRO n 1 76 THR n 1 77 ALA n 1 78 ILE n 1 79 GLU n 1 80 ALA n 1 81 THR n 1 82 VAL n 1 83 ILE n 1 84 LEU n 1 85 ASN n 1 86 SER n 1 87 GLN n 1 88 PRO n 1 89 GLU n 1 90 TRP n 1 91 ASP n 1 92 ARG n 1 93 PHE n 1 94 MET n 1 95 ARG n 1 96 PHE n 1 97 MET n 1 98 GLU n 1 99 ARG n 1 100 TYR n 1 101 GLY n 1 102 ALA n 1 103 GLU n 1 104 ASN n 1 105 GLY n 1 106 LEU n 1 107 GLY n 1 108 PHE n 1 109 SER n 1 110 LYS n 1 111 SER n 1 112 GLU n 1 113 LEU n 1 114 GLU n 1 115 HIS n 1 116 HIS n 1 117 HIS n 1 118 HIS n 1 119 HIS n 1 120 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'psb28, psbW, sll1398' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 6803' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechocystis sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1148 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pMGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'C-tag: LEHHHHHH' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PSB28_SYNY3 _struct_ref.pdbx_db_accession Q55356 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAEIQFSKGVAETVVPEVRLSKSKNGQSGMAKFYFLEPTILAKESTDDITGMYLIDDEGEIITREVKGKFINGRPTAIEA TVILNSQPEWDRFMRFMERYGAENGLGFSKSE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KVO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q55356 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 112 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KVO LEU A 113 ? UNP Q55356 ? ? 'expression tag' 113 1 1 2KVO GLU A 114 ? UNP Q55356 ? ? 'expression tag' 114 2 1 2KVO HIS A 115 ? UNP Q55356 ? ? 'expression tag' 115 3 1 2KVO HIS A 116 ? UNP Q55356 ? ? 'expression tag' 116 4 1 2KVO HIS A 117 ? UNP Q55356 ? ? 'expression tag' 117 5 1 2KVO HIS A 118 ? UNP Q55356 ? ? 'expression tag' 118 6 1 2KVO HIS A 119 ? UNP Q55356 ? ? 'expression tag' 119 7 1 2KVO HIS A 120 ? UNP Q55356 ? ? 'expression tag' 120 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC_CT' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-13C NOESY' 1 5 1 '3D HNCO' 1 6 1 '3D HNCA' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D HN(CO)CA' 1 10 1 '3D HBHA(CO)NH' 1 11 1 '3D H(CCO)NH' 1 12 1 '3D C(CO)NH' 1 13 1 '3D HCCH-TOCSY' 1 14 1 '3D HCCH-COSY' 1 15 3 '3D HCCH-TOCSY' 1 16 3 '4D CC NOESY' 1 17 1 '2D 1H-15N HSQC_swN150ppm' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.58 mM [U-100% 13C; U-100% 15N] Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803), 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.44 mM [U-5% 13C; U-100% 15N] Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803), 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.58 mM [U-100% 13C; U-100% 15N] Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803), 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 10 mM DTT, 0.02 % sodium azide, 100% D2O ; 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 850 Bruker AvanceIII 2 'Bruker AvanceIII' # _pdbx_nmr_refine.entry_id 2KVO _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Xplor-nih-2.20 with HBDB' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KVO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KVO _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2008 1 Varian collection VNMR 6.1C 2 'Bruker Biospin' collection TOPSPIN 2.1.4 3 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH 2.20 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 6 Goddard 'data analysis' SPARKY 3.113 7 'Bhattacharya and Montelione' refinement PSVS 1.4 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.30 9 '(PdbStat)-Roberto Tejero and Gaetano T. Montelione' 'structure solution' PDBSTAT 5.1 10 'Bahrami, A., Assadi, A., Markley, J. L. & Eghbalnia, H.' autoassignment PINE_Server 1.0 11 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;Solution NMR structure Photosystem II reaction center Psb28 protein Synechocystis sp.(strain PCC 6803) Northeast Structural Genomics Consortium (NESG) ; _exptl.entry_id 2KVO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KVO _struct.title ;Solution NMR structure of Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803), Northeast Structural Genomics Consortium Target SgR171 ; _struct.pdbx_descriptor 'Photosystem II reaction center psb28 protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KVO _struct_keywords.pdbx_keywords PHOTOSYNTHESIS _struct_keywords.text ;Photosystem II reaction center Psb28 protein, Membrane, Photosynthesis, Photosystem II, Thylakoid, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 38 ? ALA A 42 ? PRO A 38 ALA A 42 5 ? 5 HELX_P HELX_P2 2 SER A 45 ? ILE A 49 ? SER A 45 ILE A 49 5 ? 5 HELX_P HELX_P3 3 GLN A 87 ? ASN A 104 ? GLN A 87 ASN A 104 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 3 ? GLN A 5 ? GLU A 3 GLN A 5 A 2 MET A 52 ? ILE A 55 ? MET A 52 ILE A 55 A 3 GLU A 60 ? THR A 63 ? GLU A 60 THR A 63 B 1 GLU A 17 ? LYS A 22 ? GLU A 17 LYS A 22 B 2 GLY A 29 ? LEU A 36 ? GLY A 29 LEU A 36 B 3 ARG A 74 ? LEU A 84 ? ARG A 74 LEU A 84 B 4 VAL A 66 ? ILE A 71 ? VAL A 66 ILE A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 5 ? N GLN A 5 O TYR A 53 ? O TYR A 53 A 2 3 N MET A 52 ? N MET A 52 O THR A 63 ? O THR A 63 B 1 2 N ARG A 19 ? N ARG A 19 O LYS A 32 ? O LYS A 32 B 2 3 N GLY A 29 ? N GLY A 29 O LEU A 84 ? O LEU A 84 B 3 4 O GLU A 79 ? O GLU A 79 N LYS A 67 ? N LYS A 67 # _atom_sites.entry_id 2KVO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 HIS 120 120 120 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-07 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803)-1' 0.58 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 DTT-5 10 ? mM ? 1 'sodium azide-6' 0.02 ? % ? 1 'Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803)-7' 0.44 ? mM '[U-5% 13C; U-100% 15N]' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'calcium chloride-10' 5 ? mM ? 2 DTT-11 10 ? mM ? 2 'sodium azide-12' 0.02 ? % ? 2 'Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803)-13' 0.58 ? mM '[U-100% 13C; U-100% 15N]' 3 MES-14 20 ? mM ? 3 'sodium chloride-15' 100 ? mM ? 3 'calcium chloride-16' 5 ? mM ? 3 DTT-17 10 ? mM ? 3 'sodium azide-18' 0.02 ? % ? 3 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H3 A MET 1 ? ? H A ALA 2 ? ? 1.27 2 1 H1 A MET 1 ? ? HH22 A ARG 99 ? ? 1.34 3 3 O A ILE 49 ? ? H A GLY 51 ? ? 1.57 4 5 H3 A MET 1 ? ? H A ALA 2 ? ? 1.30 5 8 H A ALA 11 ? ? HZ1 A LYS 43 ? ? 1.34 6 8 O A SER 111 ? ? H A LEU 113 ? ? 1.54 7 9 O A ASP 56 ? ? H A GLU 58 ? ? 1.59 8 13 HD1 A HIS 115 ? ? H A HIS 117 ? ? 1.26 9 14 H3 A MET 1 ? ? H A ALA 2 ? ? 1.33 10 15 HD1 A HIS 116 ? ? HD1 A HIS 117 ? ? 1.30 11 15 O A ASP 57 ? ? H A GLY 59 ? ? 1.58 12 18 HG A SER 45 ? ? H A THR 46 ? ? 1.31 13 18 O A ILE 49 ? ? H A GLY 51 ? ? 1.52 14 18 O A ASP 57 ? ? H A GLY 59 ? ? 1.54 15 19 O A ASP 57 ? ? H A GLY 59 ? ? 1.49 16 19 O A SER 111 ? ? H A LEU 113 ? ? 1.57 17 20 H2 A MET 1 ? ? HH21 A ARG 99 ? ? 1.25 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 7 ? ? -150.64 22.56 2 1 LYS A 8 ? ? 56.53 120.52 3 1 GLN A 27 ? ? -80.23 -91.40 4 1 ILE A 40 ? ? -59.96 0.34 5 1 LYS A 43 ? ? -93.59 -73.28 6 1 GLU A 58 ? ? -88.91 -76.42 7 1 THR A 76 ? ? -152.83 -29.90 8 1 LEU A 84 ? ? -108.40 55.30 9 1 PRO A 88 ? ? -48.51 -17.48 10 1 LEU A 106 ? ? 58.05 1.57 11 1 GLU A 112 ? ? 65.31 -62.65 12 2 ALA A 2 ? ? 32.10 -89.70 13 2 SER A 7 ? ? -155.21 80.31 14 2 LYS A 8 ? ? 43.14 -168.98 15 2 VAL A 10 ? ? -78.01 -94.60 16 2 ALA A 11 ? ? 175.67 55.80 17 2 LYS A 24 ? ? 44.57 14.04 18 2 GLN A 27 ? ? -151.06 -56.38 19 2 GLU A 37 ? ? 39.35 58.88 20 2 ASP A 57 ? ? 54.86 5.26 21 2 GLU A 58 ? ? -146.75 -105.46 22 2 THR A 76 ? ? -154.34 -34.06 23 2 ASN A 104 ? ? -137.09 -150.45 24 2 LEU A 106 ? ? 39.07 26.37 25 2 SER A 109 ? ? -160.66 -137.07 26 2 LYS A 110 ? ? -66.77 81.56 27 2 SER A 111 ? ? -160.40 -75.19 28 2 LEU A 113 ? ? -99.85 -63.19 29 2 HIS A 116 ? ? 55.57 91.19 30 2 HIS A 119 ? ? 41.97 -167.26 31 3 ALA A 2 ? ? 44.75 89.35 32 3 ALA A 11 ? ? 168.85 96.89 33 3 THR A 13 ? ? 70.08 -9.41 34 3 LYS A 24 ? ? -39.45 128.71 35 3 GLU A 37 ? ? 40.32 71.85 36 3 LYS A 43 ? ? -99.73 -73.18 37 3 ILE A 49 ? ? -88.11 -87.33 38 3 THR A 50 ? ? 66.94 -40.36 39 3 GLU A 58 ? ? -87.19 -77.40 40 3 ASN A 72 ? ? -38.89 93.22 41 3 LEU A 106 ? ? 56.28 -159.58 42 3 PHE A 108 ? ? 39.55 94.04 43 3 GLU A 112 ? ? 64.52 -30.55 44 3 HIS A 116 ? ? 54.92 -176.79 45 3 HIS A 119 ? ? 44.93 92.96 46 4 ALA A 2 ? ? 41.77 93.48 47 4 GLU A 12 ? ? -101.32 43.50 48 4 SER A 23 ? ? -178.30 3.03 49 4 GLN A 27 ? ? -153.70 -36.44 50 4 SER A 28 ? ? -170.34 110.54 51 4 GLU A 37 ? ? 31.91 70.40 52 4 PRO A 38 ? ? -65.53 12.48 53 4 THR A 39 ? ? 67.70 -3.35 54 4 THR A 50 ? ? -144.77 49.06 55 4 ASN A 72 ? ? 51.53 13.86 56 4 THR A 76 ? ? -166.03 -32.71 57 4 ASN A 104 ? ? -81.24 -74.21 58 4 SER A 109 ? ? -116.92 -88.14 59 4 LYS A 110 ? ? -143.13 -57.65 60 4 GLU A 114 ? ? 28.44 57.00 61 4 HIS A 116 ? ? -150.74 49.96 62 4 HIS A 118 ? ? 51.75 -104.50 63 4 HIS A 119 ? ? -149.45 16.41 64 5 ALA A 11 ? ? 56.85 168.69 65 5 THR A 13 ? ? -168.86 -35.17 66 5 GLN A 27 ? ? -73.62 45.81 67 5 SER A 28 ? ? 61.33 178.86 68 5 GLU A 37 ? ? 37.99 70.81 69 5 ILE A 40 ? ? -66.68 2.81 70 5 GLU A 65 ? ? -141.57 -105.03 71 5 VAL A 66 ? ? 57.92 113.82 72 5 LEU A 84 ? ? -107.80 65.75 73 5 ASN A 104 ? ? -118.68 -130.83 74 5 SER A 111 ? ? -172.73 -101.21 75 5 GLU A 114 ? ? -56.93 -110.75 76 5 HIS A 118 ? ? 41.25 -117.39 77 5 HIS A 119 ? ? -164.94 100.84 78 6 ALA A 2 ? ? -164.63 -43.14 79 6 SER A 7 ? ? -168.36 -153.44 80 6 VAL A 10 ? ? 53.90 95.43 81 6 VAL A 15 ? ? 34.05 95.53 82 6 GLN A 27 ? ? -79.39 46.37 83 6 SER A 28 ? ? 62.03 -169.30 84 6 GLU A 37 ? ? 30.50 66.62 85 6 PRO A 38 ? ? -65.54 16.27 86 6 THR A 39 ? ? 50.39 14.36 87 6 ASP A 56 ? ? -151.90 -117.88 88 6 GLU A 58 ? ? -175.38 -44.51 89 6 ASN A 72 ? ? 44.08 16.41 90 6 THR A 76 ? ? -140.87 -29.86 91 6 LEU A 84 ? ? -98.62 56.83 92 6 ASN A 104 ? ? -160.57 117.13 93 6 SER A 109 ? ? 71.67 -43.02 94 6 LYS A 110 ? ? 52.35 6.83 95 6 GLU A 114 ? ? -118.14 72.09 96 6 HIS A 117 ? ? -151.45 28.16 97 7 SER A 23 ? ? -58.91 175.23 98 7 GLU A 37 ? ? 35.84 71.78 99 7 ILE A 40 ? ? -66.18 1.10 100 7 ASP A 56 ? ? -102.12 -153.95 101 7 GLU A 58 ? ? -174.15 -54.47 102 7 PRO A 75 ? ? -46.97 93.96 103 7 ASN A 104 ? ? -115.05 -140.42 104 7 LEU A 106 ? ? 39.14 92.49 105 7 SER A 109 ? ? 61.36 -5.11 106 7 LYS A 110 ? ? 33.77 30.26 107 7 HIS A 116 ? ? 43.40 81.92 108 8 ALA A 2 ? ? 56.39 113.40 109 8 PHE A 6 ? ? -94.34 -67.02 110 8 LYS A 8 ? ? 60.19 126.29 111 8 GLU A 12 ? ? -97.95 -65.95 112 8 THR A 13 ? ? 51.01 177.43 113 8 VAL A 14 ? ? 57.73 148.57 114 8 GLN A 27 ? ? -155.10 -68.74 115 8 PRO A 38 ? ? -66.83 15.38 116 8 LYS A 43 ? ? -99.55 -63.24 117 8 ASP A 56 ? ? -99.21 -132.45 118 8 GLU A 58 ? ? -149.25 -50.16 119 8 ASN A 72 ? ? -37.74 92.51 120 8 THR A 76 ? ? -132.70 -30.01 121 8 ASN A 104 ? ? 56.18 157.22 122 8 SER A 109 ? ? -100.88 -115.83 123 8 GLU A 112 ? ? 66.44 -43.01 124 8 HIS A 116 ? ? 43.64 -169.03 125 9 ALA A 2 ? ? 56.31 104.97 126 9 THR A 13 ? ? 55.24 -90.15 127 9 VAL A 14 ? ? 56.60 155.72 128 9 GLN A 27 ? ? -74.03 40.51 129 9 SER A 28 ? ? 58.45 -179.18 130 9 GLU A 37 ? ? 39.06 56.73 131 9 ILE A 40 ? ? -63.44 2.52 132 9 LYS A 43 ? ? -95.33 -75.02 133 9 THR A 50 ? ? -151.14 32.75 134 9 ASP A 57 ? ? 64.31 -62.12 135 9 ARG A 64 ? ? -102.92 -116.90 136 9 GLU A 65 ? ? 35.75 77.34 137 9 ASN A 72 ? ? -37.79 95.15 138 9 PRO A 75 ? ? -37.49 118.66 139 9 ASN A 104 ? ? -124.69 -94.23 140 9 PHE A 108 ? ? -174.84 -127.31 141 9 LEU A 113 ? ? -120.46 -132.39 142 10 ALA A 2 ? ? -0.94 95.40 143 10 PHE A 6 ? ? -70.97 -74.62 144 10 GLU A 12 ? ? -172.56 135.97 145 10 THR A 13 ? ? -92.18 -70.42 146 10 VAL A 14 ? ? 54.32 162.80 147 10 PRO A 38 ? ? -63.57 9.09 148 10 THR A 39 ? ? 51.01 19.21 149 10 GLU A 44 ? ? -171.43 139.00 150 10 THR A 50 ? ? -149.25 42.77 151 10 ASP A 56 ? ? -108.92 -149.46 152 10 GLU A 58 ? ? -156.63 -43.56 153 10 ASN A 72 ? ? -38.49 92.26 154 10 THR A 76 ? ? -147.05 -25.11 155 10 ASN A 104 ? ? -85.92 -85.11 156 10 LYS A 110 ? ? 39.48 32.48 157 10 SER A 111 ? ? -129.21 -77.24 158 10 LEU A 113 ? ? -96.75 -80.14 159 10 GLU A 114 ? ? 43.79 13.97 160 10 HIS A 117 ? ? 49.37 99.47 161 11 ALA A 11 ? ? 58.95 144.15 162 11 GLU A 12 ? ? 58.14 -88.48 163 11 THR A 13 ? ? 81.87 -78.67 164 11 ASN A 25 ? ? 56.82 15.68 165 11 GLN A 27 ? ? -46.85 -81.53 166 11 GLU A 37 ? ? 39.45 57.25 167 11 ILE A 40 ? ? -59.44 1.05 168 11 LYS A 43 ? ? -96.06 -75.89 169 11 ASP A 57 ? ? 59.92 -81.45 170 11 GLU A 58 ? ? -145.53 -38.64 171 11 ASN A 72 ? ? -38.03 92.94 172 11 ASN A 104 ? ? -94.12 -70.98 173 11 SER A 109 ? ? -63.25 71.46 174 11 LYS A 110 ? ? 61.10 -23.94 175 11 GLU A 112 ? ? 84.69 -31.89 176 11 HIS A 115 ? ? 58.18 116.49 177 11 HIS A 117 ? ? 51.86 75.48 178 11 HIS A 118 ? ? -150.58 -40.31 179 12 ALA A 2 ? ? 58.71 -72.70 180 12 LYS A 8 ? ? 57.88 124.03 181 12 ALA A 11 ? ? -92.88 -159.43 182 12 GLU A 12 ? ? 56.53 -76.49 183 12 VAL A 14 ? ? 44.07 177.60 184 12 SER A 23 ? ? -57.87 -86.63 185 12 LYS A 24 ? ? -107.07 -109.90 186 12 GLU A 37 ? ? 32.76 68.81 187 12 ILE A 40 ? ? -65.43 1.87 188 12 GLU A 58 ? ? 60.62 89.00 189 12 ASN A 72 ? ? 57.66 14.92 190 12 THR A 76 ? ? -149.12 -41.47 191 12 LEU A 106 ? ? 44.71 100.03 192 12 LYS A 110 ? ? -172.86 73.37 193 12 SER A 111 ? ? 47.00 -82.86 194 12 LEU A 113 ? ? -68.23 -93.67 195 12 GLU A 114 ? ? 41.75 -92.51 196 12 HIS A 115 ? ? 43.35 83.35 197 13 SER A 7 ? ? -155.86 43.31 198 13 LYS A 8 ? ? 31.81 43.70 199 13 GLU A 12 ? ? -85.47 -116.10 200 13 THR A 13 ? ? 57.35 0.04 201 13 VAL A 15 ? ? 62.13 60.43 202 13 SER A 23 ? ? -43.90 108.58 203 13 GLN A 27 ? ? -163.16 28.21 204 13 SER A 28 ? ? 79.58 -172.62 205 13 ILE A 40 ? ? -173.48 -27.73 206 13 GLU A 58 ? ? -169.55 97.71 207 13 LEU A 84 ? ? -101.12 79.25 208 13 ASN A 104 ? ? -159.59 -148.28 209 13 LEU A 106 ? ? 56.10 -95.11 210 13 LYS A 110 ? ? -174.61 -30.26 211 13 GLU A 112 ? ? 59.08 -68.24 212 13 GLU A 114 ? ? -169.87 -22.69 213 13 HIS A 115 ? ? 41.64 -116.44 214 13 HIS A 116 ? ? -156.49 -49.81 215 13 HIS A 117 ? ? -142.61 53.73 216 14 ALA A 11 ? ? 58.73 82.90 217 14 LYS A 24 ? ? 64.89 91.80 218 14 ASN A 25 ? ? 55.05 6.20 219 14 SER A 28 ? ? -164.11 101.14 220 14 PRO A 38 ? ? -69.68 1.36 221 14 THR A 39 ? ? 54.74 5.03 222 14 ASP A 56 ? ? -104.01 -167.36 223 14 GLU A 58 ? ? -108.75 -94.18 224 14 LEU A 106 ? ? 56.32 164.91 225 14 PHE A 108 ? ? 40.73 22.31 226 14 SER A 109 ? ? -61.65 -81.02 227 14 LYS A 110 ? ? -152.06 -55.08 228 15 VAL A 10 ? ? -101.96 -77.66 229 15 ALA A 11 ? ? -178.06 -99.00 230 15 VAL A 14 ? ? 55.51 158.12 231 15 GLN A 27 ? ? -76.14 -78.11 232 15 SER A 28 ? ? -78.44 -97.25 233 15 GLU A 37 ? ? 37.04 58.17 234 15 ILE A 40 ? ? -62.78 1.52 235 15 LYS A 43 ? ? -87.47 -74.34 236 15 THR A 50 ? ? -140.38 26.04 237 15 ASP A 56 ? ? -172.50 134.99 238 15 GLU A 58 ? ? 67.82 -40.94 239 15 ARG A 64 ? ? -101.24 41.24 240 15 THR A 76 ? ? -147.93 -34.01 241 15 ASN A 104 ? ? -93.18 -79.43 242 15 LEU A 106 ? ? -74.12 -79.29 243 15 SER A 111 ? ? 77.93 -7.56 244 15 HIS A 115 ? ? -173.46 83.58 245 15 HIS A 116 ? ? -154.35 -50.40 246 16 SER A 7 ? ? -161.10 -63.95 247 16 ALA A 11 ? ? 64.43 92.56 248 16 SER A 23 ? ? -65.52 0.74 249 16 LYS A 24 ? ? 40.53 22.06 250 16 ASN A 25 ? ? -167.45 23.71 251 16 GLU A 37 ? ? 37.35 57.69 252 16 LYS A 43 ? ? -87.47 -75.76 253 16 THR A 50 ? ? -39.60 123.01 254 16 ASP A 57 ? ? 44.82 17.46 255 16 GLU A 58 ? ? -170.40 83.40 256 16 ARG A 64 ? ? -98.74 50.37 257 16 ASN A 72 ? ? -54.35 -0.42 258 16 ARG A 74 ? ? 60.12 134.87 259 16 ASN A 104 ? ? 176.78 -166.91 260 16 LEU A 106 ? ? 44.65 22.14 261 16 SER A 111 ? ? 163.11 -72.00 262 16 HIS A 115 ? ? -155.61 -56.14 263 16 HIS A 119 ? ? 53.51 11.39 264 17 VAL A 10 ? ? -57.36 -86.97 265 17 ALA A 11 ? ? 179.23 -105.73 266 17 VAL A 14 ? ? 53.06 165.01 267 17 SER A 23 ? ? -61.69 -129.61 268 17 GLN A 27 ? ? -135.73 -113.22 269 17 PRO A 38 ? ? -68.85 13.90 270 17 GLU A 58 ? ? 68.81 -41.44 271 17 THR A 76 ? ? -157.95 -28.97 272 17 LEU A 84 ? ? -98.14 -75.63 273 17 SER A 109 ? ? -167.18 97.26 274 17 LYS A 110 ? ? 52.06 168.54 275 17 SER A 111 ? ? 61.53 136.93 276 17 GLU A 112 ? ? 56.10 5.02 277 17 HIS A 117 ? ? 54.57 163.53 278 17 HIS A 119 ? ? 51.96 -174.44 279 18 ALA A 2 ? ? 45.14 88.66 280 18 PHE A 6 ? ? -96.53 -65.75 281 18 VAL A 10 ? ? 31.46 -135.84 282 18 ALA A 11 ? ? -160.95 -139.40 283 18 VAL A 14 ? ? -87.22 -145.24 284 18 SER A 23 ? ? -159.23 25.35 285 18 GLN A 27 ? ? -145.44 -42.78 286 18 SER A 28 ? ? -175.98 -85.93 287 18 GLU A 37 ? ? 36.53 68.70 288 18 SER A 45 ? ? -63.57 -166.35 289 18 ILE A 49 ? ? -54.80 -88.62 290 18 THR A 50 ? ? 66.61 -43.18 291 18 ASP A 56 ? ? -133.23 -156.37 292 18 GLU A 58 ? ? 66.08 -39.88 293 18 PRO A 75 ? ? -42.88 104.62 294 18 PHE A 108 ? ? -133.40 -129.80 295 18 SER A 109 ? ? 70.58 -60.75 296 18 GLU A 112 ? ? 67.36 -58.38 297 19 ALA A 2 ? ? 49.75 99.54 298 19 PHE A 6 ? ? -93.83 -71.47 299 19 LYS A 8 ? ? 40.63 -168.55 300 19 GLU A 12 ? ? -137.65 -77.57 301 19 THR A 13 ? ? 37.44 31.09 302 19 SER A 23 ? ? -52.15 176.35 303 19 ILE A 40 ? ? -60.61 0.84 304 19 ASP A 56 ? ? -134.80 -80.88 305 19 GLU A 58 ? ? 65.05 -42.72 306 19 THR A 76 ? ? -161.68 -35.63 307 19 LEU A 84 ? ? -118.31 62.86 308 19 ASN A 104 ? ? -80.73 -75.69 309 19 LEU A 106 ? ? 41.25 98.42 310 19 SER A 109 ? ? -162.06 50.38 311 19 LYS A 110 ? ? 41.42 -168.99 312 19 SER A 111 ? ? 55.20 158.91 313 19 GLU A 112 ? ? 61.35 -63.11 314 19 GLU A 114 ? ? -55.78 -80.25 315 20 ALA A 2 ? ? -176.57 147.91 316 20 SER A 7 ? ? -145.99 -134.07 317 20 ALA A 11 ? ? -33.21 112.44 318 20 THR A 13 ? ? 53.26 14.02 319 20 SER A 23 ? ? 36.89 29.61 320 20 LYS A 24 ? ? 58.91 1.69 321 20 ASN A 25 ? ? -153.28 -53.51 322 20 GLN A 27 ? ? -172.79 -27.68 323 20 GLU A 37 ? ? 50.87 75.14 324 20 THR A 39 ? ? 39.63 22.58 325 20 THR A 50 ? ? -142.53 12.91 326 20 ASP A 56 ? ? -88.84 -87.85 327 20 ASP A 57 ? ? -159.37 -62.23 328 20 PRO A 75 ? ? -68.80 87.49 329 20 LEU A 84 ? ? -110.66 75.53 330 20 ASN A 104 ? ? -177.87 -160.69 331 20 PHE A 108 ? ? 54.07 167.64 332 20 SER A 111 ? ? 172.79 -84.35 333 20 HIS A 115 ? ? -153.13 -130.74 334 20 HIS A 116 ? ? -158.96 -60.06 #