data_2KVV # _entry.id 2KVV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KVV pdb_00002kvv 10.2210/pdb2kvv/pdb RCSB RCSB101637 ? ? BMRB 16795 ? ? WWPDB D_1000101637 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16795 BMRB unspecified . KpR49 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KVV _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-03-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Xiao, R.' 2 'Hamilton, K.' 3 'Acton, T.B.' 4 'Mao, B.' 5 'Everett, J.' 6 'Montelione, G.T.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target KpR49' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Xiao, R.' 2 ? primary 'Hamilton, K.' 3 ? primary 'Acton, T.B.' 4 ? primary 'Mao, B.' 5 ? primary 'Everett, J.' 6 ? primary 'Montelione, G.T.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative excisionase' _entity.formula_weight 9304.556 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MAQIIFNEEWMVEKALMVRTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDSLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier KpR49 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 GLN n 1 4 ILE n 1 5 ILE n 1 6 PHE n 1 7 ASN n 1 8 GLU n 1 9 GLU n 1 10 TRP n 1 11 MET n 1 12 VAL n 1 13 GLU n 1 14 LYS n 1 15 ALA n 1 16 LEU n 1 17 MET n 1 18 VAL n 1 19 ARG n 1 20 THR n 1 21 GLY n 1 22 LEU n 1 23 GLY n 1 24 ALA n 1 25 ARG n 1 26 GLN n 1 27 ILE n 1 28 GLU n 1 29 SER n 1 30 TYR n 1 31 ARG n 1 32 GLN n 1 33 GLY n 1 34 ALA n 1 35 TRP n 1 36 ILE n 1 37 GLU n 1 38 GLY n 1 39 VAL n 1 40 HIS n 1 41 PHE n 1 42 LYS n 1 43 ARG n 1 44 VAL n 1 45 SER n 1 46 PRO n 1 47 SER n 1 48 GLY n 1 49 GLU n 1 50 LYS n 1 51 THR n 1 52 LEU n 1 53 ARG n 1 54 GLY n 1 55 THR n 1 56 THR n 1 57 TRP n 1 58 TYR n 1 59 ASN n 1 60 TYR n 1 61 PRO n 1 62 GLU n 1 63 ILE n 1 64 ASN n 1 65 LYS n 1 66 PHE n 1 67 ILE n 1 68 ARG n 1 69 ASP n 1 70 SER n 1 71 LEU n 1 72 GLU n 1 73 HIS n 1 74 HIS n 1 75 HIS n 1 76 HIS n 1 77 HIS n 1 78 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KPN78578_13480, KPN_01377' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700721 / MGH 78578' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272620 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A6T888_KLEP7 _struct_ref.pdbx_db_accession A6T888 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAQIIFNEEWMVEKALMARTGLGARQIESYRQGAWIEGVHFKRVSPSGEKTLRGTTWYNYPEINKFIRDS _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KVV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A6T888 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KVV VAL A 18 ? UNP A6T888 ALA 18 conflict 18 1 1 2KVV LEU A 71 ? UNP A6T888 ? ? 'expression tag' 71 2 1 2KVV GLU A 72 ? UNP A6T888 ? ? 'expression tag' 72 3 1 2KVV HIS A 73 ? UNP A6T888 ? ? 'expression tag' 73 4 1 2KVV HIS A 74 ? UNP A6T888 ? ? 'expression tag' 74 5 1 2KVV HIS A 75 ? UNP A6T888 ? ? 'expression tag' 75 6 1 2KVV HIS A 76 ? UNP A6T888 ? ? 'expression tag' 76 7 1 2KVV HIS A 77 ? UNP A6T888 ? ? 'expression tag' 77 8 1 2KVV HIS A 78 ? UNP A6T888 ? ? 'expression tag' 78 9 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.7 mM [U-100% 13C; U-100% 15N] KpR49, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.8 mM [U-10% 13C; U-100% 15N] KpR49, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KVV _pdbx_nmr_refine.method 'molecular dynamics, simulated annealing, distance geometry, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KVV _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KVV _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'refinement,geometry optimization,structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 3 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 4 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis,chemical shift assignment' AutoAssign 2.1 5 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 6 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 7 'Bruker Biospin' collection TopSpin ? 8 Varian collection VnmrJ ? 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'The structure indicate it may be a transcriptional regulator, DNA binding protein' _exptl.entry_id 2KVV _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KVV _struct.title 'Solution NMR of Putative excisionase from Klebsiella pneumoniae, Northeast Structural Genomics Consortium Target Target KpR49' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KVV _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;excisionase, DNA binding, wHTH motif, Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, HYDROLASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 12 ? GLY A 21 ? VAL A 12 GLY A 21 1 ? 10 HELX_P HELX_P2 2 GLY A 23 ? GLN A 32 ? GLY A 23 GLN A 32 1 ? 10 HELX_P HELX_P3 3 TYR A 60 ? GLU A 72 ? TYR A 60 GLU A 72 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 10 ? MET A 11 ? TRP A 10 MET A 11 A 2 THR A 55 ? ASN A 59 ? THR A 55 ASN A 59 A 3 PHE A 41 ? VAL A 44 ? PHE A 41 VAL A 44 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 11 ? N MET A 11 O TYR A 58 ? O TYR A 58 A 2 3 O THR A 55 ? O THR A 55 N VAL A 44 ? N VAL A 44 # _atom_sites.entry_id 2KVV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TRP 10 10 10 TRP TRP A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 TRP 57 57 57 TRP TRP A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 HIS 78 78 78 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-04-14 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id KpR49-1 0.7 ? mM '[U-100% 13C; U-100% 15N]' 1 KpR49-2 0.8 ? mM '[U-10% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 39 ? ? -104.23 -70.47 2 1 PRO A 46 ? ? -70.06 26.04 3 1 HIS A 73 ? ? -48.38 106.89 4 1 HIS A 75 ? ? -64.71 90.33 5 2 PRO A 46 ? ? -61.55 -75.90 6 2 HIS A 75 ? ? -160.58 102.10 7 2 HIS A 77 ? ? -124.54 -62.31 8 3 ILE A 4 ? ? -69.49 86.63 9 3 ASN A 7 ? ? -173.80 142.15 10 3 PRO A 46 ? ? -76.04 24.62 11 3 LYS A 50 ? ? -104.00 73.97 12 3 GLU A 72 ? ? 59.47 -80.73 13 3 HIS A 73 ? ? 45.79 -71.76 14 3 HIS A 75 ? ? -67.72 92.81 15 4 ILE A 4 ? ? -66.93 97.22 16 4 LYS A 50 ? ? 73.47 -35.02 17 4 LEU A 52 ? ? -73.59 21.27 18 5 VAL A 39 ? ? -123.89 -73.18 19 5 SER A 47 ? ? -68.39 83.25 20 5 GLU A 49 ? ? -82.33 40.89 21 5 HIS A 76 ? ? -135.14 -51.91 22 6 ASN A 7 ? ? -171.74 -32.94 23 6 LYS A 50 ? ? -140.73 39.54 24 7 ILE A 4 ? ? -113.23 68.24 25 7 VAL A 39 ? ? -97.76 -64.99 26 7 GLU A 72 ? ? 55.22 76.91 27 7 HIS A 74 ? ? -57.76 89.98 28 7 HIS A 77 ? ? -125.05 -55.46 29 8 PRO A 46 ? ? -79.06 22.95 30 8 SER A 47 ? ? 66.02 -76.75 31 8 LYS A 50 ? ? -60.08 97.07 32 8 GLU A 72 ? ? -161.17 108.09 33 8 HIS A 77 ? ? 178.99 -42.54 34 9 ALA A 2 ? ? -176.23 130.90 35 9 LYS A 50 ? ? -60.74 86.17 36 9 GLU A 72 ? ? 68.30 -69.56 37 10 PHE A 6 ? ? -173.87 127.88 38 10 GLU A 72 ? ? 70.42 -35.24 39 11 PHE A 6 ? ? -163.46 103.41 40 11 ASN A 7 ? ? -167.90 97.58 41 11 ALA A 34 ? ? -172.71 -32.28 42 11 GLU A 72 ? ? 57.79 16.57 43 11 HIS A 74 ? ? 31.11 88.39 44 11 HIS A 75 ? ? -68.81 99.14 45 11 HIS A 77 ? ? -176.36 114.93 46 12 ASN A 7 ? ? -153.48 43.79 47 12 SER A 47 ? ? -136.24 -59.70 48 13 GLU A 72 ? ? 66.28 -71.33 49 13 HIS A 73 ? ? -58.26 99.28 50 13 HIS A 74 ? ? -47.58 99.86 51 14 ARG A 53 ? ? -64.09 82.14 52 15 LEU A 52 ? ? -69.30 -81.51 53 16 PHE A 6 ? ? -164.40 9.16 54 16 VAL A 39 ? ? -101.88 -72.89 55 17 GLU A 72 ? ? 70.09 -52.05 56 17 HIS A 73 ? ? -52.47 109.47 57 18 PHE A 6 ? ? -160.84 99.69 58 18 ALA A 34 ? ? -178.33 -34.25 59 18 SER A 47 ? ? 68.33 -5.20 60 18 HIS A 73 ? ? -60.33 98.71 61 18 HIS A 74 ? ? -148.59 -24.37 62 19 HIS A 75 ? ? -47.78 101.57 63 20 PHE A 6 ? ? -67.85 92.80 64 20 GLU A 72 ? ? -57.26 99.99 65 20 HIS A 75 ? ? -164.92 118.00 #