data_2KWF # _entry.id 2KWF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KWF RCSB RCSB101657 WWPDB D_1000101657 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KWF _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-04-08 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Denis, C.M.' 1 'Chitayat, S.' 2 'Plevin, M.J.' 3 'Liu, S.' 4 'Spencer, H.L.' 5 'Ikura, M.' 6 'LeBrun, D.P.' 7 'Smith, S.P.' 8 # _citation.id primary _citation.title 'The structure of E-protein activation domain 1 bound to the KIX domain of CBP/p300 elucidates leukemia induction by E2A-PBX1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Denis, C.M.' 1 primary 'Chitayat, S.' 2 primary 'Plevin, M.J.' 3 primary 'Liu, S.' 4 primary 'Spencer, H.L.' 5 primary 'Ikura, M.' 6 primary 'LeBrun, D.P.' 7 primary 'Smith, S.P.' 8 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CREB-binding protein' 10353.856 1 2.3.1.48 ? 'UNP residues 587-673, KIX domain' ? 2 polymer man 'Transcription factor 4' 2021.185 1 ? ? 'UNP residues 11-27' ? # _entity_name_com.entity_id 2 _entity_name_com.name ;TCF-4, Immunoglobulin transcription factor 2, ITF-2, SL3-3 enhancer factor 2, SEF-2, Class B basic helix-loop-helix protein 19, bHLHb19 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELE EKRRSRL ; ;GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELE EKRRSRL ; A ? 2 'polypeptide(L)' no no GSGTDKELSDLLDFSAMFS GSGTDKELSDLLDFSAMFS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 ARG n 1 4 LYS n 1 5 GLY n 1 6 TRP n 1 7 HIS n 1 8 GLU n 1 9 HIS n 1 10 VAL n 1 11 THR n 1 12 GLN n 1 13 ASP n 1 14 LEU n 1 15 ARG n 1 16 SER n 1 17 HIS n 1 18 LEU n 1 19 VAL n 1 20 HIS n 1 21 LYS n 1 22 LEU n 1 23 VAL n 1 24 GLN n 1 25 ALA n 1 26 ILE n 1 27 PHE n 1 28 PRO n 1 29 THR n 1 30 PRO n 1 31 ASP n 1 32 PRO n 1 33 ALA n 1 34 ALA n 1 35 LEU n 1 36 LYS n 1 37 ASP n 1 38 ARG n 1 39 ARG n 1 40 MET n 1 41 GLU n 1 42 ASN n 1 43 LEU n 1 44 VAL n 1 45 ALA n 1 46 TYR n 1 47 ALA n 1 48 LYS n 1 49 LYS n 1 50 VAL n 1 51 GLU n 1 52 GLY n 1 53 ASP n 1 54 MET n 1 55 TYR n 1 56 GLU n 1 57 SER n 1 58 ALA n 1 59 ASN n 1 60 SER n 1 61 ARG n 1 62 ASP n 1 63 GLU n 1 64 TYR n 1 65 TYR n 1 66 HIS n 1 67 LEU n 1 68 LEU n 1 69 ALA n 1 70 GLU n 1 71 LYS n 1 72 ILE n 1 73 TYR n 1 74 LYS n 1 75 ILE n 1 76 GLN n 1 77 LYS n 1 78 GLU n 1 79 LEU n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 ARG n 1 84 ARG n 1 85 SER n 1 86 ARG n 1 87 LEU n 2 1 GLY n 2 2 SER n 2 3 GLY n 2 4 THR n 2 5 ASP n 2 6 LYS n 2 7 GLU n 2 8 LEU n 2 9 SER n 2 10 ASP n 2 11 LEU n 2 12 LEU n 2 13 ASP n 2 14 PHE n 2 15 SER n 2 16 ALA n 2 17 MET n 2 18 PHE n 2 19 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human ? 'CREBBP, CBP' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'pet21a(+)' ? ? ? ? ? 2 1 sample ? ? ? human ? 'TCF4, BHLHB19, ITF2, SEF2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? pGEX-4T1 ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP CBP_HUMAN Q92793 1 ;GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELE EKRRSRL ; 587 ? 2 UNP ITF2_HUMAN P15884 2 GTDKELSDLLDFSAMFS 11 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2KWF A 1 ? 87 ? Q92793 587 ? 673 ? 1 87 2 2 2KWF B 3 ? 19 ? P15884 11 ? 27 ? 90 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 2KWF GLY B 1 ? UNP P15884 ? ? 'EXPRESSION TAG' 88 1 2 2KWF SER B 2 ? UNP P15884 ? ? 'EXPRESSION TAG' 89 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM DSS-1, 20 mM MES-2, 1 mM beta-mercaptoethanol-3, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KWF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KWF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.3 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.3 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KWF _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.6 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 2 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 3 'Bruker Biospin' collection TOPSPIN ? 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5.2.2 5 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.2.2 6 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.2.2 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KWF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KWF _struct.title 'The structure of E-protein activation domain 1 bound to the KIX domain of CBP/p300 elucidates leukemia induction by E2A-PBX1' _struct.pdbx_descriptor 'CREB-binding protein (E.C.2.3.1.48), Transcription factor 4' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KWF _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Transcription, Transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 11 ? PHE A 27 ? THR A 11 PHE A 27 1 ? 17 HELX_P HELX_P2 2 ASP A 37 ? SER A 57 ? ASP A 37 SER A 57 1 ? 21 HELX_P HELX_P3 3 SER A 60 ? ARG A 84 ? SER A 60 ARG A 84 1 ? 25 HELX_P HELX_P4 4 LYS B 6 ? PHE B 18 ? LYS B 93 PHE B 105 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KWF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 HIS 9 9 9 HIS HIS A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 MET 40 40 40 MET MET A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 MET 54 54 54 MET MET A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 TYR 64 64 64 TYR TYR A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 LEU 87 87 87 LEU LEU A . n B 2 1 GLY 1 88 88 GLY GLY B . n B 2 2 SER 2 89 89 SER SER B . n B 2 3 GLY 3 90 90 GLY GLY B . n B 2 4 THR 4 91 91 THR THR B . n B 2 5 ASP 5 92 92 ASP ASP B . n B 2 6 LYS 6 93 93 LYS LYS B . n B 2 7 GLU 7 94 94 GLU GLU B . n B 2 8 LEU 8 95 95 LEU LEU B . n B 2 9 SER 9 96 96 SER SER B . n B 2 10 ASP 10 97 97 ASP ASP B . n B 2 11 LEU 11 98 98 LEU LEU B . n B 2 12 LEU 12 99 99 LEU LEU B . n B 2 13 ASP 13 100 100 ASP ASP B . n B 2 14 PHE 14 101 101 PHE PHE B . n B 2 15 SER 15 102 102 SER SER B . n B 2 16 ALA 16 103 103 ALA ALA B . n B 2 17 MET 17 104 104 MET MET B . n B 2 18 PHE 18 105 105 PHE PHE B . n B 2 19 SER 19 106 106 SER SER B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2011-07-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id DSS-1 1 ? mM ? 1 MES-2 20 ? mM ? 1 beta-mercaptoethanol-3 1 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KWF _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1018 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 184 _pdbx_nmr_constraints.NOE_medium_range_total_count 360 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 418 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 75 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 75 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A LYS 4 ? ? H A TRP 6 ? ? 1.59 2 2 O A LYS 4 ? ? H A TRP 6 ? ? 1.60 3 3 O A LYS 4 ? ? H A TRP 6 ? ? 1.60 4 5 O A LYS 4 ? ? O A ASN 59 ? ? 2.17 5 9 O A LYS 4 ? ? H A TRP 6 ? ? 1.59 6 11 O A LYS 4 ? ? H A TRP 6 ? ? 1.59 7 16 O A LYS 4 ? ? H A TRP 6 ? ? 1.59 8 19 O A LYS 4 ? ? H A TRP 6 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 11 ? ? 51.71 166.32 2 1 ARG A 86 ? ? -142.98 -13.78 3 2 THR A 11 ? ? 53.33 170.44 4 2 ASP A 31 ? ? -177.64 110.93 5 2 ARG A 86 ? ? -140.72 -14.11 6 2 THR B 91 ? ? -92.87 -66.97 7 2 LYS B 93 ? ? -140.38 -48.86 8 3 THR A 11 ? ? 53.10 170.30 9 3 ASP A 31 ? ? -161.28 87.59 10 3 ARG A 86 ? ? -142.16 -13.79 11 3 SER B 89 ? ? -171.72 120.23 12 4 VAL A 2 ? ? 59.77 170.62 13 4 THR A 11 ? ? 48.67 -179.06 14 4 ARG A 86 ? ? -140.42 -13.54 15 4 SER B 89 ? ? -135.67 -56.01 16 4 THR B 91 ? ? 68.43 -69.11 17 4 LYS B 93 ? ? -131.45 -68.97 18 5 ARG A 3 ? ? -166.99 34.28 19 5 VAL A 10 ? ? -100.71 -62.29 20 5 THR A 11 ? ? 55.44 169.01 21 6 ARG A 3 ? ? -179.30 146.77 22 6 THR A 11 ? ? 46.34 -174.03 23 6 ASP A 31 ? ? -178.01 130.32 24 6 ARG A 86 ? ? -140.78 -14.00 25 6 SER B 89 ? ? -173.95 -41.27 26 6 THR B 91 ? ? 68.52 -69.06 27 7 ARG A 3 ? ? -99.41 42.87 28 7 THR A 11 ? ? 50.62 175.60 29 7 ASP A 31 ? ? -151.25 89.87 30 7 ARG A 86 ? ? -143.46 -13.68 31 7 THR B 91 ? ? -156.86 -74.41 32 7 LYS B 93 ? ? -99.51 30.46 33 7 PHE B 105 ? ? -97.93 36.93 34 8 VAL A 2 ? ? 65.10 170.64 35 8 ARG A 3 ? ? 60.97 163.51 36 8 THR A 11 ? ? 47.55 -178.25 37 8 ASP A 31 ? ? -177.17 130.29 38 8 ARG A 86 ? ? -142.27 -13.84 39 9 THR A 11 ? ? 53.71 164.11 40 9 ASP A 31 ? ? -152.88 89.83 41 9 ARG A 86 ? ? -143.30 -14.03 42 9 SER B 89 ? ? -64.53 80.95 43 10 VAL A 10 ? ? -121.12 -56.74 44 10 THR A 11 ? ? 44.44 -173.95 45 10 ASP A 31 ? ? -163.52 88.52 46 10 ARG A 86 ? ? -143.77 -13.73 47 11 THR A 11 ? ? 53.86 169.38 48 11 ARG A 86 ? ? -144.96 -14.06 49 11 THR B 91 ? ? 68.56 -68.12 50 11 LYS B 93 ? ? -143.52 36.59 51 12 VAL A 2 ? ? 64.81 170.63 52 12 THR A 11 ? ? 45.79 179.69 53 12 ASP A 31 ? ? -155.61 75.32 54 12 ARG A 86 ? ? -141.59 -14.20 55 12 THR B 91 ? ? -76.03 -74.50 56 12 ASP B 92 ? ? 60.10 85.96 57 13 ARG A 3 ? ? 62.75 163.79 58 13 LYS A 4 ? ? -49.62 160.74 59 13 THR A 11 ? ? 55.61 167.75 60 13 SER B 89 ? ? 68.33 -68.55 61 14 ASP A 31 ? ? -165.75 86.23 62 14 ARG A 86 ? ? -142.44 -13.91 63 15 VAL A 2 ? ? 60.38 170.64 64 15 THR A 11 ? ? 54.47 168.34 65 15 ASP A 31 ? ? -158.64 75.58 66 15 ARG A 86 ? ? -141.64 -14.13 67 15 THR B 91 ? ? 60.51 169.57 68 15 LYS B 93 ? ? -132.23 -49.41 69 16 THR A 11 ? ? 52.93 164.50 70 16 ASP A 31 ? ? -167.57 90.21 71 16 THR B 91 ? ? 52.87 -86.23 72 17 THR A 11 ? ? 48.61 175.31 73 17 ASP A 31 ? ? -154.61 85.68 74 17 ARG A 86 ? ? -142.52 -13.96 75 17 THR B 91 ? ? 56.76 168.92 76 17 ASP B 92 ? ? 60.01 174.16 77 17 LYS B 93 ? ? 69.43 -65.72 78 18 VAL A 10 ? ? -103.19 -62.89 79 18 THR A 11 ? ? 56.26 168.10 80 18 ASP A 31 ? ? -153.83 78.47 81 18 ARG A 86 ? ? -142.04 -13.92 82 18 LYS B 93 ? ? -132.69 -46.71 83 18 PHE B 105 ? ? -98.28 35.51 84 19 THR A 11 ? ? 51.62 176.14 85 19 ASP A 31 ? ? -161.71 92.03 86 19 ARG A 86 ? ? -142.46 -13.76 87 19 THR B 91 ? ? 60.73 -177.11 88 20 VAL A 2 ? ? 65.32 170.58 89 20 LYS A 4 ? ? 59.71 8.27 90 20 VAL A 10 ? ? -100.46 -62.57 91 20 THR A 11 ? ? 55.55 168.81 92 20 ASP A 31 ? ? -153.57 85.43 93 20 ARG A 86 ? ? -142.41 -13.71 94 20 SER B 89 ? ? 60.49 95.31 95 20 THR B 91 ? ? 60.37 169.69 96 20 LYS B 93 ? ? -155.72 -50.33 #