data_2KXE # _entry.id 2KXE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KXE pdb_00002kxe 10.2210/pdb2kxe/pdb RCSB RCSB101692 ? ? BMRB 16986 ? ? WWPDB D_1000101692 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16986 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KXE _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-04-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yamasaki, K.' 1 'Matsui, I.' 2 # _citation.id primary _citation.title ;Solution structure of the N-terminal domain of the archaeal D-family DNA polymerase small subunit reveals evolutionary relationship to eukaryotic B-family polymerases ; _citation.journal_abbrev 'Febs Lett.' _citation.journal_volume 584 _citation.page_first 3370 _citation.page_last 3375 _citation.year 2010 _citation.journal_id_ASTM FEBLAL _citation.country NE _citation.journal_id_ISSN 0014-5793 _citation.journal_id_CSD 0165 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20598295 _citation.pdbx_database_id_DOI 10.1016/j.febslet.2010.06.026 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yamasaki, K.' 1 ? primary 'Urushibata, Y.' 2 ? primary 'Yamasaki, T.' 3 ? primary 'Arisaka, F.' 4 ? primary 'Matsui, I.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DNA polymerase II small subunit' _entity.formula_weight 8534.804 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.7.7 _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1-72' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DP1 subunit, Pol II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK _entity_poly.pdbx_seq_one_letter_code_can GSHMDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASP n 1 6 GLU n 1 7 PHE n 1 8 VAL n 1 9 LYS n 1 10 GLY n 1 11 LEU n 1 12 MET n 1 13 LYS n 1 14 ASN n 1 15 GLY n 1 16 TYR n 1 17 LEU n 1 18 ILE n 1 19 THR n 1 20 PRO n 1 21 SER n 1 22 ALA n 1 23 TYR n 1 24 TYR n 1 25 LEU n 1 26 LEU n 1 27 VAL n 1 28 GLY n 1 29 HIS n 1 30 PHE n 1 31 ASN n 1 32 GLU n 1 33 GLY n 1 34 LYS n 1 35 PHE n 1 36 SER n 1 37 LEU n 1 38 ILE n 1 39 GLU n 1 40 LEU n 1 41 ILE n 1 42 LYS n 1 43 PHE n 1 44 ALA n 1 45 LYS n 1 46 SER n 1 47 ARG n 1 48 GLU n 1 49 THR n 1 50 PHE n 1 51 ILE n 1 52 ILE n 1 53 ASP n 1 54 ASP n 1 55 GLU n 1 56 ILE n 1 57 ALA n 1 58 ASN n 1 59 GLU n 1 60 PHE n 1 61 LEU n 1 62 LYS n 1 63 SER n 1 64 ILE n 1 65 GLY n 1 66 ALA n 1 67 GLU n 1 68 VAL n 1 69 GLU n 1 70 LEU n 1 71 PRO n 1 72 GLN n 1 73 GLU n 1 74 ILE n 1 75 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 53953 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DP2S_PYRHO _struct_ref.pdbx_db_accession O57863 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MDEFVKGLMKNGYLITPSAYYLLVGHFNEGKFSLIELIKFAKSRETFIIDDEIANEFLKSIGAEVELPQEIK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KXE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 75 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O57863 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 72 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KXE GLY A 1 ? UNP O57863 ? ? 'expression tag' -2 1 1 2KXE SER A 2 ? UNP O57863 ? ? 'expression tag' -1 2 1 2KXE HIS A 3 ? UNP O57863 ? ? 'expression tag' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D DQF-COSY' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCA' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D HCCH-COSY' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-15N TOCSY' 1 12 1 '3D 1H-13C NOESY' 1 13 1 '3D HMQC-NOESY-HMQC' 1 14 1 '2D 1H-15N HSQC' 2 15 2 '2D 1H-15N HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 0.15 5.5 ambient ? 318 K 2 0.15 5.5 ambient ? 298 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.7-3.3mM sodium phosphate; 0.7-3.3mM [U-99% 15N] sodium phosphate; 0.7-3.3mM [U-99% 13C; U-99% 15N] sodium phosphate; 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' '3.3mM [U-99% 15N] sodium phosphate; 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 750 Bruker DMX 1 'Bruker DMX' 500 Bruker DMX 2 'Bruker DMX' # _pdbx_nmr_refine.entry_id 2KXE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KXE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KXE _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ? 'structure solution' CNS 1.1 1 ? refinement CNS 1.1 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KXE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KXE _struct.title 'N-terminal domain of the DP1 subunit of an archaeal D-family DNA polymerase' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KXE _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'DNA polymerase, D-family, small subunit, archara, helical bundle, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 5 ? LYS A 13 ? ASP A 2 LYS A 10 1 ? 9 HELX_P HELX_P2 2 THR A 19 ? GLU A 32 ? THR A 16 GLU A 29 1 ? 14 HELX_P HELX_P3 3 SER A 36 ? GLU A 48 ? SER A 33 GLU A 45 1 ? 13 HELX_P HELX_P4 4 ASP A 53 ? GLY A 65 ? ASP A 50 GLY A 62 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 17 ? ILE A 18 ? LEU A 14 ILE A 15 A 2 ILE A 51 ? ILE A 52 ? ILE A 48 ILE A 49 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 17 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 14 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 52 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 49 # _atom_sites.entry_id 2KXE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 ASP 5 2 2 ASP ASP A . n A 1 6 GLU 6 3 3 GLU GLU A . n A 1 7 PHE 7 4 4 PHE PHE A . n A 1 8 VAL 8 5 5 VAL VAL A . n A 1 9 LYS 9 6 6 LYS LYS A . n A 1 10 GLY 10 7 7 GLY GLY A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 MET 12 9 9 MET MET A . n A 1 13 LYS 13 10 10 LYS LYS A . n A 1 14 ASN 14 11 11 ASN ASN A . n A 1 15 GLY 15 12 12 GLY GLY A . n A 1 16 TYR 16 13 13 TYR TYR A . n A 1 17 LEU 17 14 14 LEU LEU A . n A 1 18 ILE 18 15 15 ILE ILE A . n A 1 19 THR 19 16 16 THR THR A . n A 1 20 PRO 20 17 17 PRO PRO A . n A 1 21 SER 21 18 18 SER SER A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 TYR 23 20 20 TYR TYR A . n A 1 24 TYR 24 21 21 TYR TYR A . n A 1 25 LEU 25 22 22 LEU LEU A . n A 1 26 LEU 26 23 23 LEU LEU A . n A 1 27 VAL 27 24 24 VAL VAL A . n A 1 28 GLY 28 25 25 GLY GLY A . n A 1 29 HIS 29 26 26 HIS HIS A . n A 1 30 PHE 30 27 27 PHE PHE A . n A 1 31 ASN 31 28 28 ASN ASN A . n A 1 32 GLU 32 29 29 GLU GLU A . n A 1 33 GLY 33 30 30 GLY GLY A . n A 1 34 LYS 34 31 31 LYS LYS A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 SER 36 33 33 SER SER A . n A 1 37 LEU 37 34 34 LEU LEU A . n A 1 38 ILE 38 35 35 ILE ILE A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 ILE 41 38 38 ILE ILE A . n A 1 42 LYS 42 39 39 LYS LYS A . n A 1 43 PHE 43 40 40 PHE PHE A . n A 1 44 ALA 44 41 41 ALA ALA A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 SER 46 43 43 SER SER A . n A 1 47 ARG 47 44 44 ARG ARG A . n A 1 48 GLU 48 45 45 GLU GLU A . n A 1 49 THR 49 46 46 THR THR A . n A 1 50 PHE 50 47 47 PHE PHE A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 ILE 52 49 49 ILE ILE A . n A 1 53 ASP 53 50 50 ASP ASP A . n A 1 54 ASP 54 51 51 ASP ASP A . n A 1 55 GLU 55 52 52 GLU GLU A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 ALA 57 54 54 ALA ALA A . n A 1 58 ASN 58 55 55 ASN ASN A . n A 1 59 GLU 59 56 56 GLU GLU A . n A 1 60 PHE 60 57 57 PHE PHE A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 LYS 62 59 59 LYS LYS A . n A 1 63 SER 63 60 60 SER SER A . n A 1 64 ILE 64 61 61 ILE ILE A . n A 1 65 GLY 65 62 62 GLY GLY A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 GLU 67 64 64 GLU GLU A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 GLU 69 66 66 GLU GLU A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 GLN 72 69 69 GLN GLN A . n A 1 73 GLU 73 70 70 GLU GLU A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 LYS 75 72 72 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_struct_ref_seq_dif.details' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate-1' ? 0.7-3.3 mM ? 1 'sodium phosphate-2' ? 0.7-3.3 mM '[U-99% 15N]' 1 'sodium phosphate-3' ? 0.7-3.3 mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate-4' 3.3 ? mM '[U-99% 15N]' 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 65 ? ? -65.45 79.79 2 1 GLN A 69 ? ? -106.87 -63.61 3 1 GLU A 70 ? ? 60.15 93.85 4 2 GLU A 45 ? ? 62.77 60.11 5 2 GLU A 70 ? ? -62.57 -176.08 6 3 GLU A 66 ? ? -154.73 35.03 7 3 LEU A 67 ? ? -172.67 85.96 8 3 ILE A 71 ? ? 62.95 140.54 9 4 LEU A 67 ? ? -113.85 70.19 10 4 GLN A 69 ? ? -172.14 -168.31 11 4 GLU A 70 ? ? -161.09 -44.90 12 5 LYS A 31 ? ? -90.72 -62.17 13 5 ILE A 48 ? ? -69.93 94.96 14 5 ASP A 50 ? ? -101.26 -168.62 15 5 ALA A 63 ? ? -104.19 70.92 16 5 VAL A 65 ? ? 64.24 89.81 17 6 ILE A 15 ? ? -175.58 117.16 18 6 PHE A 47 ? ? -98.64 31.74 19 6 LEU A 67 ? ? 59.87 84.88 20 6 GLU A 70 ? ? -177.35 -39.66 21 7 ASN A 11 ? ? -98.81 30.14 22 7 PHE A 47 ? ? -98.51 30.70 23 7 GLN A 69 ? ? -59.34 174.61 24 8 ASP A 2 ? ? 54.87 74.89 25 8 PHE A 47 ? ? -104.91 43.90 26 8 GLU A 64 ? ? -170.09 110.95 27 9 PHE A 47 ? ? -98.62 32.54 28 9 GLN A 69 ? ? -147.88 -65.00 29 10 VAL A 65 ? ? -178.02 112.17 30 10 GLU A 66 ? ? -178.49 -39.69 31 11 GLU A 66 ? ? 62.94 111.79 32 11 PRO A 68 ? ? -69.51 81.18 33 11 GLN A 69 ? ? -176.33 94.55 34 11 GLU A 70 ? ? 61.57 153.90 35 12 THR A 46 ? ? -162.24 109.84 36 12 GLU A 64 ? ? 60.41 84.53 37 12 LEU A 67 ? ? -155.27 85.66 38 12 GLU A 70 ? ? 60.22 -177.67 39 13 GLU A 45 ? ? 62.74 62.14 40 13 GLU A 64 ? ? -174.36 95.41 41 13 ILE A 71 ? ? 64.00 136.64 42 14 PHE A 47 ? ? -98.06 31.12 43 14 ASP A 50 ? ? -118.38 -169.65 44 14 VAL A 65 ? ? -98.41 31.03 45 14 GLU A 66 ? ? -170.06 121.10 46 14 ILE A 71 ? ? 63.60 150.34 47 15 ASP A 2 ? ? 60.29 62.84 48 15 ILE A 49 ? ? -69.90 93.26 49 15 ALA A 63 ? ? -106.72 63.61 50 15 GLU A 66 ? ? -108.87 52.75 51 16 ALA A 63 ? ? -69.86 95.31 52 16 GLU A 66 ? ? 56.45 95.07 53 16 GLN A 69 ? ? -118.42 78.76 54 17 THR A 46 ? ? -166.86 105.99 55 17 ILE A 48 ? ? -69.84 96.34 56 17 GLU A 64 ? ? -153.04 71.43 57 18 PHE A 47 ? ? -98.32 31.21 58 18 ALA A 63 ? ? -71.57 -166.67 59 18 GLU A 64 ? ? 64.87 90.76 60 18 LEU A 67 ? ? 58.90 102.63 61 19 LYS A 31 ? ? -93.95 -65.87 62 19 ALA A 63 ? ? -96.24 41.64 63 19 ILE A 71 ? ? 58.30 83.17 64 20 GLU A 45 ? ? 70.65 38.90 65 20 PHE A 47 ? ? -96.95 39.93 66 20 GLU A 66 ? ? 178.13 -38.47 67 20 LEU A 67 ? ? 58.34 72.87 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A HIS 0 ? A HIS 3 31 11 Y 1 A GLY -2 ? A GLY 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A HIS 0 ? A HIS 3 34 12 Y 1 A GLY -2 ? A GLY 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A HIS 0 ? A HIS 3 37 13 Y 1 A GLY -2 ? A GLY 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A HIS 0 ? A HIS 3 40 14 Y 1 A GLY -2 ? A GLY 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A HIS 0 ? A HIS 3 43 15 Y 1 A GLY -2 ? A GLY 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A HIS 0 ? A HIS 3 46 16 Y 1 A GLY -2 ? A GLY 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A HIS 0 ? A HIS 3 49 17 Y 1 A GLY -2 ? A GLY 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A HIS 0 ? A HIS 3 52 18 Y 1 A GLY -2 ? A GLY 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A HIS 0 ? A HIS 3 55 19 Y 1 A GLY -2 ? A GLY 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A HIS 0 ? A HIS 3 58 20 Y 1 A GLY -2 ? A GLY 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A HIS 0 ? A HIS 3 #