data_2KYL # _entry.id 2KYL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KYL pdb_00002kyl 10.2210/pdb2kyl/pdb RCSB RCSB101735 ? ? WWPDB D_1000101735 ? ? BMRB 16967 ? ? # _pdbx_database_related.db_id 16967 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KYL _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-06-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Terrien, E.' 1 'Wolff, N.' 2 'Cordier, F.' 3 'Simenel, C.' 4 'Lafon, M.' 5 'Delepierre, M.' 6 # _citation.id primary _citation.title 'Solution structure of MAST2-PDZ complexed with the C-terminus of PTEN' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Terrien, E.' 1 ? primary 'Wolff, N.' 2 ? primary 'Cordier, F.' 3 ? primary 'Simenel, C.' 4 ? primary 'Lafon, M.' 5 ? primary 'Prehaud, C.' 6 ? primary 'Delepierre, M.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Microtubule-associated serine/threonine-protein kinase 2' 10451.940 1 2.7.11.1 ? 'PDZ domain' ? 2 polymer syn 'C-terminus of Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN' 1559.674 1 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'C-terminus of PTEN' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELI LKSGNKVAISTTPLEN ; ;GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELI LKSGNKVAISTTPLEN ; A ? 2 'polypeptide(L)' no no PFDEDQHTQITKV PFDEDQHTQITKV B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 MET n 1 5 ARG n 1 6 PRO n 1 7 PRO n 1 8 ILE n 1 9 ILE n 1 10 ILE n 1 11 HIS n 1 12 ARG n 1 13 ALA n 1 14 GLY n 1 15 LYS n 1 16 LYS n 1 17 TYR n 1 18 GLY n 1 19 PHE n 1 20 THR n 1 21 LEU n 1 22 ARG n 1 23 ALA n 1 24 ILE n 1 25 ARG n 1 26 VAL n 1 27 TYR n 1 28 MET n 1 29 GLY n 1 30 ASP n 1 31 SER n 1 32 ASP n 1 33 VAL n 1 34 TYR n 1 35 THR n 1 36 VAL n 1 37 HIS n 1 38 HIS n 1 39 MET n 1 40 VAL n 1 41 TRP n 1 42 HIS n 1 43 VAL n 1 44 GLU n 1 45 ASP n 1 46 GLY n 1 47 GLY n 1 48 PRO n 1 49 ALA n 1 50 SER n 1 51 GLU n 1 52 ALA n 1 53 GLY n 1 54 LEU n 1 55 ARG n 1 56 GLN n 1 57 GLY n 1 58 ASP n 1 59 LEU n 1 60 ILE n 1 61 THR n 1 62 HIS n 1 63 VAL n 1 64 ASN n 1 65 GLY n 1 66 GLU n 1 67 PRO n 1 68 VAL n 1 69 HIS n 1 70 GLY n 1 71 LEU n 1 72 VAL n 1 73 HIS n 1 74 THR n 1 75 GLU n 1 76 VAL n 1 77 VAL n 1 78 GLU n 1 79 LEU n 1 80 ILE n 1 81 LEU n 1 82 LYS n 1 83 SER n 1 84 GLY n 1 85 ASN n 1 86 LYS n 1 87 VAL n 1 88 ALA n 1 89 ILE n 1 90 SER n 1 91 THR n 1 92 THR n 1 93 PRO n 1 94 LEU n 1 95 GLU n 1 96 ASN n 2 1 PRO n 2 2 PHE n 2 3 ASP n 2 4 GLU n 2 5 ASP n 2 6 GLN n 2 7 HIS n 2 8 THR n 2 9 GLN n 2 10 ILE n 2 11 THR n 2 12 LYS n 2 13 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pDEST15 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'synthetic peptide' # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP MAST2_HUMAN Q6P0Q8 1 ;GSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELIL KSGNKVAISTTPLEN ; 1099 ? 2 UNP PTEN_HUMAN P60484 2 PFDEDQHTQITKV 391 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2KYL A 2 ? 96 ? Q6P0Q8 1099 ? 1193 ? 2 96 2 2 2KYL B 1 ? 13 ? P60484 391 ? 403 ? 97 109 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2KYL _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q6P0Q8 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HN(CO)CA' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D HNCA' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY' 1 12 1 '3D HN(COCA)CB' 1 13 1 '3D_13C-selected/12C,14N-selected NOESY' 1 14 1 '3D_15N-selected/12C,14N-selected NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.6mM [U-100% 13C; U-100% 15N] PDZ-domain-1, 1.2mM PTEN-2, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KYL _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KYL _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.38 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KYL _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.2 5 Varian collection VnmrJ ? 6 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 7 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 8 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 9 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KYL _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KYL _struct.title 'Solution structure of MAST2-PDZ complexed with the C-terminus of PTEN' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KYL _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'PDZ, complex, kinase, Transferase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 47 ? GLY A 53 ? GLY A 47 GLY A 53 1 ? 7 HELX_P HELX_P2 2 VAL A 72 ? SER A 83 ? VAL A 72 SER A 83 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 7 ? HIS A 11 ? PRO A 7 HIS A 11 A 2 LYS A 86 ? THR A 92 ? LYS A 86 THR A 92 A 3 LEU A 59 ? VAL A 63 ? LEU A 59 VAL A 63 A 4 GLU A 66 ? PRO A 67 ? GLU A 66 PRO A 67 B 1 TYR A 34 ? VAL A 43 ? TYR A 34 VAL A 43 B 2 PHE A 19 ? TYR A 27 ? PHE A 19 TYR A 27 B 3 GLN B 9 ? VAL B 13 ? GLN B 105 VAL B 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 8 ? N ILE A 8 O ILE A 89 ? O ILE A 89 A 2 3 O SER A 90 ? O SER A 90 N HIS A 62 ? N HIS A 62 A 3 4 N VAL A 63 ? N VAL A 63 O GLU A 66 ? O GLU A 66 B 1 2 O HIS A 42 ? O HIS A 42 N THR A 20 ? N THR A 20 B 2 3 N LEU A 21 ? N LEU A 21 O THR B 11 ? O THR B 107 # _atom_sites.entry_id 2KYL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 HIS 11 11 11 HIS HIS A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 HIS 37 37 37 HIS HIS A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 MET 39 39 39 MET MET A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASN 96 96 96 ASN ASN A . n B 2 1 PRO 1 97 97 PRO PRO B . n B 2 2 PHE 2 98 98 PHE PHE B . n B 2 3 ASP 3 99 99 ASP ASP B . n B 2 4 GLU 4 100 100 GLU GLU B . n B 2 5 ASP 5 101 101 ASP ASP B . n B 2 6 GLN 6 102 102 GLN GLN B . n B 2 7 HIS 7 103 103 HIS HIS B . n B 2 8 THR 8 104 104 THR THR B . n B 2 9 GLN 9 105 105 GLN GLN B . n B 2 10 ILE 10 106 106 ILE ILE B . n B 2 11 THR 11 107 107 THR THR B . n B 2 12 LYS 12 108 108 LYS LYS B . n B 2 13 VAL 13 109 109 VAL VAL B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-06-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0524 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0005 _pdbx_nmr_ensemble_rms.entry_id 2KYL _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id PDZ-domain-1 0.6 ? mM '[U-100% 13C; U-100% 15N]' 1 PTEN-2 1.2 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KYL _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1317 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 570 _pdbx_nmr_constraints.NOE_long_range_total_count 270 _pdbx_nmr_constraints.NOE_medium_range_total_count 155 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 244 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 10 _pdbx_validate_close_contact.auth_atom_id_1 H2 _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 PRO _pdbx_validate_close_contact.auth_seq_id_1 97 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 OD1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 ASP _pdbx_validate_close_contact.auth_seq_id_2 99 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 4 ? ? -142.97 -43.52 2 1 ALA A 13 ? ? -116.47 66.53 3 1 LYS A 15 ? ? -159.05 -47.52 4 1 ASP A 30 ? ? -167.83 -59.27 5 1 SER A 31 ? ? -110.17 -154.83 6 1 ASP A 58 ? ? -84.88 -157.53 7 1 ASN A 85 ? ? 73.73 -54.33 8 1 PRO A 93 ? ? -48.51 150.10 9 1 GLN B 102 ? ? -67.89 -79.16 10 2 MET A 4 ? ? -157.15 -59.09 11 2 ALA A 13 ? ? -130.80 -146.03 12 2 SER A 31 ? ? -152.11 -109.49 13 2 ASP A 58 ? ? -83.78 -155.90 14 2 HIS A 69 ? ? -68.99 92.81 15 2 ASN A 85 ? ? 74.12 -48.63 16 2 LEU A 94 ? ? -103.76 78.31 17 2 ASP B 99 ? ? -66.30 -90.26 18 2 GLN B 102 ? ? -70.10 -89.50 19 3 ASP A 30 ? ? -165.03 -57.82 20 3 SER A 31 ? ? -110.27 -157.66 21 3 ASP A 58 ? ? -88.41 -158.90 22 3 ASN A 85 ? ? 73.61 -41.85 23 3 LEU A 94 ? ? -107.50 74.39 24 3 PHE B 98 ? ? 62.78 -166.01 25 3 ASP B 99 ? ? -162.73 -78.80 26 3 HIS B 103 ? ? -112.44 78.23 27 4 MET A 4 ? ? -165.82 -58.20 28 4 ILE A 9 ? ? -69.38 97.39 29 4 ASP A 30 ? ? -176.43 -52.42 30 4 SER A 31 ? ? -130.40 -155.04 31 4 ASP A 58 ? ? -86.08 -153.19 32 4 ASN A 85 ? ? 75.53 -45.36 33 4 LEU A 94 ? ? -105.77 68.17 34 4 ASP B 99 ? ? -88.78 -148.40 35 4 ASP B 101 ? ? -87.88 37.20 36 5 MET A 4 ? ? -155.62 -43.69 37 5 LYS A 15 ? ? -133.00 -37.79 38 5 ASN A 85 ? ? 75.03 -43.64 39 5 LEU A 94 ? ? -108.96 77.92 40 5 PHE B 98 ? ? 47.71 -171.18 41 5 GLU B 100 ? ? 74.62 159.74 42 5 ASP B 101 ? ? -162.82 -76.55 43 5 GLN B 102 ? ? 57.70 -134.98 44 6 MET A 4 ? ? -155.42 -52.63 45 6 ASP A 30 ? ? -155.79 -58.68 46 6 SER A 31 ? ? -140.57 -145.88 47 6 ASN A 85 ? ? 75.73 -46.13 48 6 LEU A 94 ? ? -107.28 63.57 49 6 PHE B 98 ? ? 63.60 -82.92 50 6 ASP B 101 ? ? -150.75 -23.56 51 6 GLN B 102 ? ? -179.40 -47.97 52 7 MET A 4 ? ? -138.66 -46.28 53 7 ASP A 30 ? ? -148.72 -61.20 54 7 SER A 31 ? ? -135.46 -137.82 55 7 ASP A 58 ? ? -88.48 -156.61 56 7 ASN A 85 ? ? 75.76 -42.62 57 7 PRO A 93 ? ? -49.56 152.25 58 7 THR B 104 ? ? -69.54 -82.00 59 8 MET A 4 ? ? -140.47 -43.09 60 8 ALA A 13 ? ? -159.39 -134.33 61 8 SER A 31 ? ? -155.31 -151.10 62 8 HIS A 69 ? ? -66.75 92.23 63 8 ASN A 85 ? ? 75.38 -46.11 64 8 PRO A 93 ? ? -47.93 151.51 65 8 ASP B 99 ? ? 61.40 -146.59 66 8 GLU B 100 ? ? -98.22 45.85 67 8 HIS B 103 ? ? -173.24 81.11 68 9 MET A 4 ? ? -153.55 -38.53 69 9 ILE A 9 ? ? -68.67 97.62 70 9 ALA A 13 ? ? -120.97 -132.45 71 9 ASP A 30 ? ? -169.65 -52.60 72 9 SER A 31 ? ? -123.07 -150.72 73 9 ASP A 58 ? ? -90.19 -157.12 74 9 ASN A 85 ? ? 72.47 -40.82 75 9 LEU A 94 ? ? -106.17 79.75 76 9 ASP B 99 ? ? -93.01 -78.42 77 9 THR B 104 ? ? -135.09 -81.35 78 10 MET A 4 ? ? -129.29 -53.05 79 10 ASP A 30 ? ? -178.89 -33.78 80 10 ASP A 58 ? ? -91.30 -150.73 81 10 LEU A 71 ? ? -77.14 -168.24 82 10 ASN A 85 ? ? 75.36 -37.43 83 10 LEU A 94 ? ? -110.76 76.40 84 10 ASP B 101 ? ? -74.03 -75.75 #