data_2KYQ # _entry.id 2KYQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KYQ RCSB RCSB101740 BMRB 16978 WWPDB D_1000101740 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 2KGQ PDB 'WT-brazzein, revised structure' unspecified 1BRZ PDB 'WT-brazzein, original structure' unspecified 16978 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KYQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dittli, S.M.' 1 'Assadi-Porter, F.M.' 2 'Rao, H.' 3 'Tonelli, M.' 4 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structural role of the terminal disulfide bond in the sweetness of brazzein.' 'Chem Senses' 36 821 830 2011 ? UK 1464-3553 ? ? 21765060 10.1093/chemse/bjr057 1 'Insights into the sweetness of brazzein from beta-hairpin peptides derived from the N- and C- termini of brazzein' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Dittli, S.M.' 1 primary 'Rao, H.' 2 primary 'Tonelli, M.' 3 primary 'Quijada, J.' 4 primary 'Markley, J.L.' 5 primary 'Max, M.' 6 primary 'Assadi-Porter, F.' 7 1 'Dittli, S.M.' 8 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Defensin-like protein' _entity.formula_weight 6408.243 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'K3C, C4K, K5R' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name Brazzein # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DCKRKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _entity_poly.pdbx_seq_one_letter_code_can DCKRKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 CYS n 1 3 LYS n 1 4 ARG n 1 5 LYS n 1 6 VAL n 1 7 TYR n 1 8 GLU n 1 9 ASN n 1 10 TYR n 1 11 PRO n 1 12 VAL n 1 13 SER n 1 14 LYS n 1 15 CYS n 1 16 GLN n 1 17 LEU n 1 18 ALA n 1 19 ASN n 1 20 GLN n 1 21 CYS n 1 22 ASN n 1 23 TYR n 1 24 ASP n 1 25 CYS n 1 26 LYS n 1 27 LEU n 1 28 ASP n 1 29 LYS n 1 30 HIS n 1 31 ALA n 1 32 ARG n 1 33 SER n 1 34 GLY n 1 35 GLU n 1 36 CYS n 1 37 PHE n 1 38 TYR n 1 39 ASP n 1 40 GLU n 1 41 LYS n 1 42 ARG n 1 43 ASN n 1 44 LEU n 1 45 GLN n 1 46 CYS n 1 47 ILE n 1 48 CYS n 1 49 ASP n 1 50 TYR n 1 51 CYS n 1 52 GLU n 1 53 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pentadiplandra brazzeana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 43545 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-CodonPlus (DE3) RIPL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pEt9a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF_PENBA _struct_ref.pdbx_db_accession P56552 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KYQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56552 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KYQ CYS A 2 ? UNP P56552 LYS 3 'ENGINEERED MUTATION' 3 1 1 2KYQ LYS A 3 ? UNP P56552 CYS 4 'ENGINEERED MUTATION' 4 2 1 2KYQ ARG A 4 ? UNP P56552 LYS 5 'ENGINEERED MUTATION' 5 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D H(CCO)NH' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' 1 11 2 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 5.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system 'mM [U-99% 13C; U-99% 15N] CKR-brazzein, 17 uM DSS, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 'mM [U-99% 15N] CKR-brazzein, 17 uM DSS, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 900 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KYQ _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KYQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KYQ _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal Varian collection VNMRJ ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 3 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 4 Goddard 'chemical shift assignment' SPARKY ? 5 Goddard 'peak picking' SPARKY ? 6 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 7 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 8 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 9 'Bhattacharya and Montelione' validation PSVS ? 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Triple brazzein mutant: K3C,C4K,K5R' _exptl.entry_id 2KYQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KYQ _struct.title '1H, 15N, 13C chemical shifts and structure of CKR-brazzein' _struct.pdbx_descriptor 'Defensin-like protein' _struct.pdbx_model_details 'closest to the average, model 9' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KYQ _struct_keywords.pdbx_keywords 'PLANT PROTEIN' _struct_keywords.text 'SWEET-TASTING PROTEIN, PLANT PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 11 ? GLN A 16 ? PRO A 12 GLN A 17 5 ? 6 HELX_P HELX_P2 2 LEU A 17 ? LYS A 26 ? LEU A 18 LYS A 27 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 3 A CYS 52 1_555 ? ? ? ? ? ? ? 1.984 ? disulf2 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 36 SG ? ? A CYS 16 A CYS 37 1_555 ? ? ? ? ? ? ? 1.967 ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 22 A CYS 47 1_555 ? ? ? ? ? ? ? 1.945 ? disulf4 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 26 A CYS 49 1_555 ? ? ? ? ? ? ? 2.039 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 2 ? VAL A 6 ? CYS A 3 VAL A 7 A 2 LEU A 44 ? CYS A 51 ? LEU A 45 CYS A 52 A 3 GLU A 35 ? TYR A 38 ? GLU A 36 TYR A 39 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 5 ? N LYS A 6 O CYS A 48 ? O CYS A 49 A 2 3 O ILE A 47 ? O ILE A 48 N GLU A 35 ? N GLU A 36 # _atom_sites.entry_id 2KYQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 2 2 ASP ASP A . n A 1 2 CYS 2 3 3 CYS CYS A . n A 1 3 LYS 3 4 4 LYS LYS A . n A 1 4 ARG 4 5 5 ARG ARG A . n A 1 5 LYS 5 6 6 LYS LYS A . n A 1 6 VAL 6 7 7 VAL VAL A . n A 1 7 TYR 7 8 8 TYR TYR A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 ASN 9 10 10 ASN ASN A . n A 1 10 TYR 10 11 11 TYR TYR A . n A 1 11 PRO 11 12 12 PRO PRO A . n A 1 12 VAL 12 13 13 VAL VAL A . n A 1 13 SER 13 14 14 SER SER A . n A 1 14 LYS 14 15 15 LYS LYS A . n A 1 15 CYS 15 16 16 CYS CYS A . n A 1 16 GLN 16 17 17 GLN GLN A . n A 1 17 LEU 17 18 18 LEU LEU A . n A 1 18 ALA 18 19 19 ALA ALA A . n A 1 19 ASN 19 20 20 ASN ASN A . n A 1 20 GLN 20 21 21 GLN GLN A . n A 1 21 CYS 21 22 22 CYS CYS A . n A 1 22 ASN 22 23 23 ASN ASN A . n A 1 23 TYR 23 24 24 TYR TYR A . n A 1 24 ASP 24 25 25 ASP ASP A . n A 1 25 CYS 25 26 26 CYS CYS A . n A 1 26 LYS 26 27 27 LYS LYS A . n A 1 27 LEU 27 28 28 LEU LEU A . n A 1 28 ASP 28 29 29 ASP ASP A . n A 1 29 LYS 29 30 30 LYS LYS A . n A 1 30 HIS 30 31 31 HIS HIS A . n A 1 31 ALA 31 32 32 ALA ALA A . n A 1 32 ARG 32 33 33 ARG ARG A . n A 1 33 SER 33 34 34 SER SER A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 GLU 35 36 36 GLU GLU A . n A 1 36 CYS 36 37 37 CYS CYS A . n A 1 37 PHE 37 38 38 PHE PHE A . n A 1 38 TYR 38 39 39 TYR TYR A . n A 1 39 ASP 39 40 40 ASP ASP A . n A 1 40 GLU 40 41 41 GLU GLU A . n A 1 41 LYS 41 42 42 LYS LYS A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 ASN 43 44 44 ASN ASN A . n A 1 44 LEU 44 45 45 LEU LEU A . n A 1 45 GLN 45 46 46 GLN GLN A . n A 1 46 CYS 46 47 47 CYS CYS A . n A 1 47 ILE 47 48 48 ILE ILE A . n A 1 48 CYS 48 49 49 CYS CYS A . n A 1 49 ASP 49 50 50 ASP ASP A . n A 1 50 TYR 50 51 51 TYR TYR A . n A 1 51 CYS 51 52 52 CYS CYS A . n A 1 52 GLU 52 53 53 GLU GLU A . n A 1 53 TYR 53 54 54 TYR TYR A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-08-03 4 'Structure model' 1 3 2011-11-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CKR-brazzein-1 ? 0.3-1 mM '[U-99% 13C; U-99% 15N]' 1 DSS-2 17 ? uM ? 1 CKR-brazzein-3 ? 0.3-1 mM '[U-99% 15N]' 2 DSS-4 17 ? uM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KYQ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 28 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 741 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 157 _pdbx_nmr_constraints.NOE_long_range_total_count 213 _pdbx_nmr_constraints.NOE_medium_range_total_count 134 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 249 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 94 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 94 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 5 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 22 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 SG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 CYS _pdbx_validate_close_contact.auth_seq_id_2 37 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 32 ? ? -61.11 -165.07 2 1 ARG A 33 ? ? -132.18 -40.06 3 2 ALA A 32 ? ? -61.16 -165.13 4 2 ARG A 33 ? ? -132.57 -43.31 5 3 ALA A 32 ? ? -60.65 -165.67 6 3 ARG A 33 ? ? -131.61 -42.05 7 4 TYR A 8 ? ? -101.91 73.89 8 4 ALA A 32 ? ? -61.01 -165.24 9 4 ARG A 33 ? ? -132.98 -43.84 10 5 ALA A 32 ? ? -60.91 -165.87 11 5 ARG A 33 ? ? -132.11 -37.84 12 6 ALA A 32 ? ? -60.70 -165.88 13 6 ARG A 33 ? ? -131.02 -39.86 14 7 ALA A 32 ? ? -61.39 -164.85 15 7 ARG A 33 ? ? -133.40 -40.84 16 8 ALA A 32 ? ? -61.11 -165.19 17 8 ARG A 33 ? ? -132.25 -39.76 18 9 ALA A 32 ? ? -61.65 -163.54 19 9 ARG A 33 ? ? -134.43 -40.51 20 10 ALA A 32 ? ? -60.82 -165.56 21 10 ARG A 33 ? ? -131.94 -40.37 22 11 ALA A 32 ? ? -61.29 -164.41 23 11 ARG A 33 ? ? -134.20 -40.06 24 12 ALA A 32 ? ? -61.07 -165.67 25 12 ARG A 33 ? ? -133.12 -39.24 26 12 ASP A 40 ? ? -101.14 -169.83 27 13 ALA A 32 ? ? -61.46 -164.27 28 13 ARG A 33 ? ? -132.96 -38.73 29 14 ALA A 32 ? ? -60.82 -165.59 30 14 ARG A 33 ? ? -131.62 -39.45 31 15 ALA A 32 ? ? -61.00 -164.63 32 15 ARG A 33 ? ? -133.10 -39.93 33 16 ALA A 32 ? ? -60.62 -164.82 34 16 ARG A 33 ? ? -132.32 -40.34 35 17 ALA A 32 ? ? -60.34 -166.03 36 17 ARG A 33 ? ? -131.56 -40.07 37 18 ALA A 32 ? ? -61.76 -161.93 38 18 ARG A 33 ? ? -135.93 -36.91 39 19 ALA A 32 ? ? -61.71 -162.92 40 19 ARG A 33 ? ? -134.15 -37.96 41 20 ALA A 32 ? ? -61.15 -163.71 42 20 ARG A 33 ? ? -134.32 -41.07 #