data_2KYR # _entry.id 2KYR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KYR pdb_00002kyr 10.2210/pdb2kyr/pdb RCSB RCSB101741 ? ? WWPDB D_1000101741 ? ? BMRB 16979 ? 10.13018/BMR16979 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other 7 4 'Structure model' 'Database references' 8 4 'Structure model' Other 9 5 'Structure model' 'Data collection' 10 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_assembly 7 3 'Structure model' pdbx_struct_oper_list 8 3 'Structure model' struct_ref_seq_dif 9 4 'Structure model' database_2 10 4 'Structure model' pdbx_database_status 11 5 'Structure model' chem_comp_atom 12 5 'Structure model' chem_comp_bond 13 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' 8 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KYR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-07 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB ER315 . unspecified BMRB 16979 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, B.' 1 'Yee, A.' 2 'Gutmanas, A.' 3 'Semest, A.' 4 'Montelione, G.T.' 5 'Arrowsmith, C.H.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 'Ontario Centre for Structural Proteomics (OCSP)' 8 # _citation.id primary _citation.title ;Solution structure of Enzyme IIB subunit of PTS system from Escherichia coli K12, Northeast Structural Genomics Consortium target ER315/Ontario Center for Structural Proteomics target ec0544 ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, B.' 1 ? primary 'Yee, A.' 2 ? primary 'Gutmanas, A.' 3 ? primary 'Semest, A.' 4 ? primary 'Arrowsmith, C.H.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Fructose-like phosphotransferase enzyme IIB component 1' _entity.formula_weight 12068.594 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.69 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PTS system fructose-like EIIB component 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFES RDVYEITLQDAIKNAAGIIKEIEEMIASEQQ ; _entity_poly.pdbx_seq_one_letter_code_can ;QGHMSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFES RDVYEITLQDAIKNAAGIIKEIEEMIASEQQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ER315 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 GLY n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 LYS n 1 7 LYS n 1 8 LEU n 1 9 ILE n 1 10 ALA n 1 11 LEU n 1 12 CYS n 1 13 ALA n 1 14 CYS n 1 15 PRO n 1 16 MET n 1 17 GLY n 1 18 LEU n 1 19 ALA n 1 20 HIS n 1 21 THR n 1 22 PHE n 1 23 MET n 1 24 ALA n 1 25 ALA n 1 26 GLN n 1 27 ALA n 1 28 LEU n 1 29 GLU n 1 30 GLU n 1 31 ALA n 1 32 ALA n 1 33 VAL n 1 34 GLU n 1 35 ALA n 1 36 GLY n 1 37 TYR n 1 38 GLU n 1 39 VAL n 1 40 LYS n 1 41 ILE n 1 42 GLU n 1 43 THR n 1 44 GLN n 1 45 GLY n 1 46 ALA n 1 47 ASP n 1 48 GLY n 1 49 ILE n 1 50 GLN n 1 51 ASN n 1 52 ARG n 1 53 LEU n 1 54 THR n 1 55 ALA n 1 56 GLN n 1 57 ASP n 1 58 ILE n 1 59 ALA n 1 60 GLU n 1 61 ALA n 1 62 THR n 1 63 ILE n 1 64 ILE n 1 65 ILE n 1 66 HIS n 1 67 SER n 1 68 VAL n 1 69 ALA n 1 70 VAL n 1 71 THR n 1 72 PRO n 1 73 GLU n 1 74 ASP n 1 75 ASN n 1 76 GLU n 1 77 ARG n 1 78 PHE n 1 79 GLU n 1 80 SER n 1 81 ARG n 1 82 ASP n 1 83 VAL n 1 84 TYR n 1 85 GLU n 1 86 ILE n 1 87 THR n 1 88 LEU n 1 89 GLN n 1 90 ASP n 1 91 ALA n 1 92 ILE n 1 93 LYS n 1 94 ASN n 1 95 ALA n 1 96 ALA n 1 97 GLY n 1 98 ILE n 1 99 ILE n 1 100 LYS n 1 101 GLU n 1 102 ILE n 1 103 GLU n 1 104 GLU n 1 105 MET n 1 106 ILE n 1 107 ALA n 1 108 SER n 1 109 GLU n 1 110 GLN n 1 111 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'fryB, ypdH, b2387, JW5389' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 LYS 7 4 4 LYS LYS A . n A 1 8 LEU 8 5 5 LEU LEU A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 CYS 12 9 9 CYS CYS A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 CYS 14 11 11 CYS CYS A . n A 1 15 PRO 15 12 12 PRO PRO A . n A 1 16 MET 16 13 13 MET MET A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 ALA 19 16 16 ALA ALA A . n A 1 20 HIS 20 17 17 HIS HIS A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 PHE 22 19 19 PHE PHE A . n A 1 23 MET 23 20 20 MET MET A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 GLN 26 23 23 GLN GLN A . n A 1 27 ALA 27 24 24 ALA ALA A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 GLU 30 27 27 GLU GLU A . n A 1 31 ALA 31 28 28 ALA ALA A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 VAL 33 30 30 VAL VAL A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 GLY 36 33 33 GLY GLY A . n A 1 37 TYR 37 34 34 TYR TYR A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 LYS 40 37 37 LYS LYS A . n A 1 41 ILE 41 38 38 ILE ILE A . n A 1 42 GLU 42 39 39 GLU GLU A . n A 1 43 THR 43 40 40 THR THR A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 GLY 45 42 42 GLY GLY A . n A 1 46 ALA 46 43 43 ALA ALA A . n A 1 47 ASP 47 44 44 ASP ASP A . n A 1 48 GLY 48 45 45 GLY GLY A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 GLN 50 47 47 GLN GLN A . n A 1 51 ASN 51 48 48 ASN ASN A . n A 1 52 ARG 52 49 49 ARG ARG A . n A 1 53 LEU 53 50 50 LEU LEU A . n A 1 54 THR 54 51 51 THR THR A . n A 1 55 ALA 55 52 52 ALA ALA A . n A 1 56 GLN 56 53 53 GLN GLN A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 ALA 59 56 56 ALA ALA A . n A 1 60 GLU 60 57 57 GLU GLU A . n A 1 61 ALA 61 58 58 ALA ALA A . n A 1 62 THR 62 59 59 THR THR A . n A 1 63 ILE 63 60 60 ILE ILE A . n A 1 64 ILE 64 61 61 ILE ILE A . n A 1 65 ILE 65 62 62 ILE ILE A . n A 1 66 HIS 66 63 63 HIS HIS A . n A 1 67 SER 67 64 64 SER SER A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 ALA 69 66 66 ALA ALA A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 THR 71 68 68 THR THR A . n A 1 72 PRO 72 69 69 PRO PRO A . n A 1 73 GLU 73 70 70 GLU GLU A . n A 1 74 ASP 74 71 71 ASP ASP A . n A 1 75 ASN 75 72 72 ASN ASN A . n A 1 76 GLU 76 73 73 GLU GLU A . n A 1 77 ARG 77 74 74 ARG ARG A . n A 1 78 PHE 78 75 75 PHE PHE A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 SER 80 77 77 SER SER A . n A 1 81 ARG 81 78 78 ARG ARG A . n A 1 82 ASP 82 79 79 ASP ASP A . n A 1 83 VAL 83 80 80 VAL VAL A . n A 1 84 TYR 84 81 81 TYR TYR A . n A 1 85 GLU 85 82 82 GLU GLU A . n A 1 86 ILE 86 83 83 ILE ILE A . n A 1 87 THR 87 84 84 THR THR A . n A 1 88 LEU 88 85 85 LEU LEU A . n A 1 89 GLN 89 86 86 GLN GLN A . n A 1 90 ASP 90 87 87 ASP ASP A . n A 1 91 ALA 91 88 88 ALA ALA A . n A 1 92 ILE 92 89 89 ILE ILE A . n A 1 93 LYS 93 90 90 LYS LYS A . n A 1 94 ASN 94 91 91 ASN ASN A . n A 1 95 ALA 95 92 92 ALA ALA A . n A 1 96 ALA 96 93 93 ALA ALA A . n A 1 97 GLY 97 94 94 GLY GLY A . n A 1 98 ILE 98 95 95 ILE ILE A . n A 1 99 ILE 99 96 96 ILE ILE A . n A 1 100 LYS 100 97 97 LYS LYS A . n A 1 101 GLU 101 98 98 GLU GLU A . n A 1 102 ILE 102 99 99 ILE ILE A . n A 1 103 GLU 103 100 100 GLU GLU A . n A 1 104 GLU 104 101 101 GLU GLU A . n A 1 105 MET 105 102 102 MET MET A . n A 1 106 ILE 106 103 103 ILE ILE A . n A 1 107 ALA 107 104 104 ALA ALA A . n A 1 108 SER 108 105 105 SER SER A . n A 1 109 GLU 109 106 106 GLU GLU A . n A 1 110 GLN 110 107 107 GLN GLN A . n A 1 111 GLN 111 108 108 GLN GLN A . n # _cell.entry_id 2KYR _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KYR _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KYR _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KYR _struct.title ;Solution structure of Enzyme IIB subunit of PTS system from Escherichia coli K12. Northeast Structural Genomics Consortium target ER315/Ontario Center for Structural Proteomics target ec0544 ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KYR _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;Fructose-like phosphotransferase enzyme IIB component 1, alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTFB1_ECOLI _struct_ref.pdbx_db_accession P69808 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDV YEITLQDAIKNAAGIIKEIEEMIASEQQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KYR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P69808 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KYR GLN A 1 ? UNP P69808 ? ? 'expression tag' -2 1 1 2KYR GLY A 2 ? UNP P69808 ? ? 'expression tag' -1 2 1 2KYR HIS A 3 ? UNP P69808 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 17 ? ALA A 35 ? GLY A 14 ALA A 32 1 ? 19 HELX_P HELX_P2 2 THR A 54 ? ALA A 61 ? THR A 51 ALA A 58 1 ? 8 HELX_P HELX_P3 3 ASP A 74 ? GLU A 79 ? ASP A 71 GLU A 76 5 ? 6 HELX_P HELX_P4 4 GLN A 89 ? ASN A 94 ? GLN A 86 ASN A 91 1 ? 6 HELX_P HELX_P5 5 ASN A 94 ? GLN A 111 ? ASN A 91 GLN A 108 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 48 ? GLN A 50 ? GLY A 45 GLN A 47 A 2 GLU A 38 ? GLY A 45 ? GLU A 35 GLY A 42 A 3 LYS A 7 ? CYS A 14 ? LYS A 4 CYS A 11 A 4 ILE A 63 ? VAL A 68 ? ILE A 60 VAL A 65 A 5 VAL A 83 ? THR A 87 ? VAL A 80 THR A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 50 ? O GLN A 47 N THR A 43 ? N THR A 40 A 2 3 O GLU A 42 ? O GLU A 39 N CYS A 12 ? N CYS A 9 A 3 4 N LEU A 11 ? N LEU A 8 O ILE A 65 ? O ILE A 62 A 4 5 N ILE A 64 ? N ILE A 61 O TYR A 84 ? O TYR A 81 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HB3 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 71 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH11 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 74 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.35 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 58 ? ? -53.15 100.49 2 2 SER A 2 ? ? -67.29 99.69 3 2 ASN A 48 ? ? 79.82 -54.21 4 2 ARG A 49 ? ? 65.32 144.63 5 3 ASN A 48 ? ? 79.10 -49.94 6 3 ARG A 49 ? ? 66.86 122.82 7 4 ALA A 58 ? ? -54.93 99.81 8 5 ALA A 58 ? ? -56.93 99.65 9 5 ASP A 79 ? ? -68.65 99.58 10 6 LYS A 3 ? ? -66.18 -174.42 11 7 ALA A 58 ? ? -51.92 102.60 12 9 ALA A 58 ? ? -63.35 96.74 13 10 MET A 13 ? ? -99.40 -62.36 14 11 SER A 2 ? ? -65.75 98.67 15 11 ALA A 58 ? ? -55.73 102.56 16 13 SER A 2 ? ? -64.08 99.60 17 13 ALA A 58 ? ? -52.75 99.37 18 15 MET A 13 ? ? -83.46 -71.76 19 16 ALA A 58 ? ? -56.19 99.04 20 17 ASN A 48 ? ? 79.06 -51.92 21 17 ARG A 49 ? ? 63.57 121.63 22 17 ALA A 58 ? ? -61.90 99.00 23 18 ASN A 48 ? ? 74.39 -64.87 24 18 ARG A 49 ? ? 63.73 129.19 25 18 ALA A 58 ? ? -56.57 101.88 26 20 LYS A 3 ? ? -79.86 -169.25 27 20 ALA A 58 ? ? -58.53 108.01 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG 'PSI, Protein Structure Initiative' 'Ontario Centre for Structural Proteomics' 2 OCSP ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KYR _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KYR _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-100% 13C; U-100% 15N] ec0544-1, 10 mM [U-100% 2H] TRIS-2, 300 mM sodium chloride-3, 10 uM zinc sulphate-4, 10 mM [U-100% 2H] DTT-5, 10 mM benzamidine-6, 1 % inhibitor cocktail-7, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.5 mM [U-7% 13C; U-100% 15N] ec0544-8, 10 mM [U-100% 2H] TRIS-9, 300 mM sodium chloride-10, 10 uM zinc sulphate-11, 10 mM [U-100% 2H] DTT-12, 10 mM benzamidine-13, 1 % inhibitor cocktail-14, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ec0544-1 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 TRIS-2 10 ? mM '[U-100% 2H]' 1 'sodium chloride-3' 300 ? mM ? 1 'zinc sulphate-4' 10 ? uM ? 1 DTT-5 10 ? mM '[U-100% 2H]' 1 benzamidine-6 10 ? mM ? 1 'inhibitor cocktail-7' 1 ? % ? 1 ec0544-8 0.5 ? mM '[U-7% 13C; U-100% 15N]' 2 TRIS-9 10 ? mM '[U-100% 2H]' 2 'sodium chloride-10' 300 ? mM ? 2 'zinc sulphate-11' 10 ? uM ? 2 DTT-12 10 ? mM '[U-100% 2H]' 2 benzamidine-13 10 ? mM ? 2 'inhibitor cocktail-14' 1 ? % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HBHA(CO)NH' 1 4 1 '3D HNCA' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D CCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D 1H-13C NOESY aromatic' 1 10 2 '2D 1H-13C HSQC' # _pdbx_nmr_refine.entry_id 2KYR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 1 'Gutmanas, Arrowsmith' processing MDDGUI 1.0 2 Goddard 'data analysis' Sparky 3.95 3 Goddard 'peak picking' Sparky 3.95 4 'Lemak, Arrowsmith' 'chemical shift assignment' FAWN 1.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 7 'Huang, Tejero, Powers and Montelione' 'nmr structure quality assessment' AutoStructure ? 8 'Bhattacharya and Montelione' 'nmr structure quality assessment' PSVS ? 9 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN -2 ? A GLN 1 2 1 Y 1 A GLY -1 ? A GLY 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLN -2 ? A GLN 1 5 2 Y 1 A GLY -1 ? A GLY 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLN -2 ? A GLN 1 8 3 Y 1 A GLY -1 ? A GLY 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLN -2 ? A GLN 1 11 4 Y 1 A GLY -1 ? A GLY 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLN -2 ? A GLN 1 14 5 Y 1 A GLY -1 ? A GLY 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLN -2 ? A GLN 1 17 6 Y 1 A GLY -1 ? A GLY 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLN -2 ? A GLN 1 20 7 Y 1 A GLY -1 ? A GLY 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLN -2 ? A GLN 1 23 8 Y 1 A GLY -1 ? A GLY 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLN -2 ? A GLN 1 26 9 Y 1 A GLY -1 ? A GLY 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLN -2 ? A GLN 1 29 10 Y 1 A GLY -1 ? A GLY 2 30 10 Y 1 A HIS 0 ? A HIS 3 31 11 Y 1 A GLN -2 ? A GLN 1 32 11 Y 1 A GLY -1 ? A GLY 2 33 11 Y 1 A HIS 0 ? A HIS 3 34 12 Y 1 A GLN -2 ? A GLN 1 35 12 Y 1 A GLY -1 ? A GLY 2 36 12 Y 1 A HIS 0 ? A HIS 3 37 13 Y 1 A GLN -2 ? A GLN 1 38 13 Y 1 A GLY -1 ? A GLY 2 39 13 Y 1 A HIS 0 ? A HIS 3 40 14 Y 1 A GLN -2 ? A GLN 1 41 14 Y 1 A GLY -1 ? A GLY 2 42 14 Y 1 A HIS 0 ? A HIS 3 43 15 Y 1 A GLN -2 ? A GLN 1 44 15 Y 1 A GLY -1 ? A GLY 2 45 15 Y 1 A HIS 0 ? A HIS 3 46 16 Y 1 A GLN -2 ? A GLN 1 47 16 Y 1 A GLY -1 ? A GLY 2 48 16 Y 1 A HIS 0 ? A HIS 3 49 17 Y 1 A GLN -2 ? A GLN 1 50 17 Y 1 A GLY -1 ? A GLY 2 51 17 Y 1 A HIS 0 ? A HIS 3 52 18 Y 1 A GLN -2 ? A GLN 1 53 18 Y 1 A GLY -1 ? A GLY 2 54 18 Y 1 A HIS 0 ? A HIS 3 55 19 Y 1 A GLN -2 ? A GLN 1 56 19 Y 1 A GLY -1 ? A GLY 2 57 19 Y 1 A HIS 0 ? A HIS 3 58 20 Y 1 A GLN -2 ? A GLN 1 59 20 Y 1 A GLY -1 ? A GLY 2 60 20 Y 1 A HIS 0 ? A HIS 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2KYR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_