data_2KZ0 # _entry.id 2KZ0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KZ0 pdb_00002kz0 10.2210/pdb2kz0/pdb RCSB RCSB101750 ? ? WWPDB D_1000101750 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id EhchA.10365.a _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KZ0 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-10 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 # _citation.id primary _citation.title ;Structural characterization of a BolA protein (ECH_0303) from Ehrlichia chaffeensis, the agent responsible for human monocytotropic ehrlichiosis. ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Hewitt, S.N.' 2 ? primary 'Napuli, A.J.' 3 ? primary 'Van Voorhis, W.C.' 4 ? primary 'Myler, P.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'BolA family protein' _entity.formula_weight 8479.720 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK _entity_poly.pdbx_seq_one_letter_code_can PGSMTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier EhchA.10365.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLY n 1 3 SER n 1 4 MET n 1 5 THR n 1 6 VAL n 1 7 THR n 1 8 GLN n 1 9 SER n 1 10 GLN n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 LEU n 1 15 ILE n 1 16 ARG n 1 17 ASN n 1 18 ALA n 1 19 PHE n 1 20 PRO n 1 21 GLU n 1 22 ALA n 1 23 GLU n 1 24 ILE n 1 25 THR n 1 26 VAL n 1 27 THR n 1 28 SER n 1 29 LEU n 1 30 VAL n 1 31 GLY n 1 32 ASP n 1 33 ASN n 1 34 ASN n 1 35 HIS n 1 36 TYR n 1 37 SER n 1 38 ILE n 1 39 LYS n 1 40 VAL n 1 41 ILE n 1 42 SER n 1 43 SER n 1 44 GLN n 1 45 PHE n 1 46 GLN n 1 47 GLY n 1 48 LYS n 1 49 SER n 1 50 LYS n 1 51 LEU n 1 52 GLU n 1 53 GLN n 1 54 HIS n 1 55 ARG n 1 56 MET n 1 57 ILE n 1 58 TYR n 1 59 LYS n 1 60 VAL n 1 61 LEU n 1 62 ASP n 1 63 GLY n 1 64 LEU n 1 65 ASN n 1 66 ILE n 1 67 HIS n 1 68 ALA n 1 69 ILE n 1 70 GLN n 1 71 ILE n 1 72 GLN n 1 73 THR n 1 74 GLY n 1 75 CYS n 1 76 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ECH_0303 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Arkansas _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ehrlichia chaffeensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 205920 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector AVA0421 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2GHF9_EHRCR _struct_ref.pdbx_db_accession Q2GHF9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDGLNIHAIQIQTGCK _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KZ0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 76 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2GHF9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 73 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 76 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KZ0 PRO A 1 ? UNP Q2GHF9 ? ? 'expression tag' 1 1 1 2KZ0 GLY A 2 ? UNP Q2GHF9 ? ? 'expression tag' 2 2 1 2KZ0 SER A 3 ? UNP Q2GHF9 ? ? 'expression tag' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCACB' 1 4 1 '3D HNCO' 1 5 1 '3D HN(COCA)CB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 2 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 7.1 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.5 mM [U-99% 13C; U-99% 15N] ECH_0303, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.0 mM [U-99% 13C; U-99% 15N] ECH_0303, 100 mM sodium chloride, 20 mM TRIS, 1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KZ0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA (AUTOMATED NOESY ASSIGNMENTS). A TOTAL OF 20 STRUCTURES OUT OF 100 WITH LOWEST TARGET FUNCTION FROM THE FINAL CYANA CALCULATION WERE TAKEN AND REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS) AFTER ADDING 1% TO THE UPPER BOUNDARY LIMIT OF THE DISTANCE RESTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KZ0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KZ0 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Accelrys Software Inc.' processing Felix 2007 2 Goddard 'data analysis' Sparky 3.115 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KZ0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KZ0 _struct.title ;Solution structure of a BolA protein (ECH_0303) from Ehrlichia chaffeensis. Seattle Structural Genomics Center for Infectious Disease target EhchA.10365.a ; _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KZ0 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;BolA protein family, human monocytotropic ehrlichiosis, stress response, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 8 ? PHE A 19 ? GLN A 8 PHE A 19 1 ? 12 HELX_P HELX_P2 2 GLN A 44 ? GLN A 46 ? GLN A 44 GLN A 46 5 ? 3 HELX_P HELX_P3 3 SER A 49 ? LEU A 61 ? SER A 49 LEU A 61 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 22 ? THR A 27 ? ALA A 22 THR A 27 A 2 SER A 37 ? SER A 42 ? SER A 37 SER A 42 A 3 ILE A 71 ? THR A 73 ? ILE A 71 THR A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 25 ? N THR A 25 O LYS A 39 ? O LYS A 39 A 2 3 N ILE A 38 ? N ILE A 38 O GLN A 72 ? O GLN A 72 # _atom_sites.entry_id 2KZ0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 LYS 76 76 76 LYS LYS A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-23 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ECH_0303-1 1.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium chloride-2' 100 ? mM ? 1 TRIS-3 20 ? mM ? 1 DTT-4 1 ? mM ? 1 ECH_0303-5 1.0 ? mM '[U-99% 13C; U-99% 15N]' 2 'sodium chloride-6' 100 ? mM ? 2 TRIS-7 20 ? mM ? 2 DTT-8 1 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KZ0 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 462 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 190 _pdbx_nmr_constraints.NOE_long_range_total_count 79 _pdbx_nmr_constraints.NOE_medium_range_total_count 90 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 103 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 52 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 52 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 10 HG1 A THR 5 ? ? OD2 A ASP 32 ? ? 1.58 2 14 HB A THR 27 ? ? HB2 A SER 37 ? ? 1.32 3 18 HB3 A PHE 45 ? ? HE22 A GLN 53 ? ? 1.35 4 18 HZ3 A LYS 59 ? ? OD1 A ASP 62 ? ? 1.58 5 20 HZ1 A LYS 48 ? ? OE1 A GLU 52 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 33 ? ? -145.55 -43.75 2 2 GLU A 21 ? ? -99.63 30.49 3 2 HIS A 67 ? ? -166.92 -54.26 4 3 ASP A 32 ? ? 61.57 90.15 5 3 ASP A 62 ? ? 75.38 -47.56 6 4 ASN A 33 ? ? -96.00 36.01 7 4 GLN A 70 ? ? -145.78 28.69 8 5 ASP A 32 ? ? -100.73 -67.15 9 5 ASP A 62 ? ? 58.50 76.65 10 5 LEU A 64 ? ? -110.50 -80.41 11 6 LEU A 64 ? ? 63.44 71.63 12 6 HIS A 67 ? ? 71.84 -7.45 13 7 ASN A 34 ? ? -94.95 -77.31 14 7 LEU A 61 ? ? -98.10 32.29 15 8 LEU A 61 ? ? -94.25 35.19 16 9 SER A 3 ? ? 54.86 18.63 17 9 ASN A 65 ? ? -139.62 -57.96 18 10 LEU A 29 ? ? -135.81 -51.87 19 10 ASP A 32 ? ? -135.73 -63.36 20 11 ASN A 34 ? ? -81.03 -79.44 21 11 ASP A 62 ? ? 55.97 77.79 22 12 LEU A 29 ? ? -124.83 -160.67 23 12 ASP A 62 ? ? 53.75 73.07 24 13 ASP A 62 ? ? 57.05 70.16 25 14 LEU A 61 ? ? -98.93 35.89 26 15 MET A 4 ? ? -103.79 71.18 27 15 GLU A 21 ? ? -96.54 35.33 28 15 VAL A 30 ? ? 61.72 89.92 29 15 ASP A 62 ? ? 50.55 75.35 30 17 ASN A 65 ? ? 55.54 78.55 31 17 ILE A 69 ? ? -81.05 38.22 32 18 VAL A 30 ? ? -63.36 91.17 33 18 LEU A 64 ? ? -100.94 -163.56 34 19 SER A 3 ? ? 49.11 -90.55 35 19 MET A 4 ? ? 70.66 -14.00 36 19 ASP A 32 ? ? 69.99 -18.31 37 19 ASP A 62 ? ? 73.28 -56.32 38 19 ALA A 68 ? ? 70.05 -30.48 39 19 ILE A 69 ? ? -72.94 23.54 40 20 VAL A 30 ? ? -167.73 114.29 41 20 ASP A 62 ? ? 55.45 74.64 #