data_2KZ3 # _entry.id 2KZ3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KZ3 pdb_00002kz3 10.2210/pdb2kz3/pdb RCSB RCSB101753 ? ? WWPDB D_1000101753 ? ? BMRB 16996 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 16996 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KZ3 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-06-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Choi, N.' 1 'Kim, Y.' 2 # _citation.id primary _citation.title 'Structural and functional characterization of the N-terminal domain of human Rad51D' _citation.journal_abbrev 'Int.J.Biochem.Cell Biol.' _citation.journal_volume 43 _citation.page_first 416 _citation.page_last 422 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1357-2725 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21111057 _citation.pdbx_database_id_DOI 10.1016/j.biocel.2010.11.014 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, Y.M.' 1 ? primary 'Choi, B.S.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative uncharacterized protein RAD51L3' _entity.formula_weight 9070.666 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-83' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTA ILS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTA ILS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 VAL n 1 4 LEU n 1 5 ARG n 1 6 VAL n 1 7 GLY n 1 8 LEU n 1 9 CYS n 1 10 PRO n 1 11 GLY n 1 12 LEU n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 MET n 1 17 ILE n 1 18 GLN n 1 19 LEU n 1 20 LEU n 1 21 ARG n 1 22 SER n 1 23 HIS n 1 24 ARG n 1 25 ILE n 1 26 LYS n 1 27 THR n 1 28 VAL n 1 29 VAL n 1 30 ASP n 1 31 LEU n 1 32 VAL n 1 33 SER n 1 34 ALA n 1 35 ASP n 1 36 LEU n 1 37 GLU n 1 38 GLU n 1 39 VAL n 1 40 ALA n 1 41 GLN n 1 42 LYS n 1 43 CYS n 1 44 GLY n 1 45 LEU n 1 46 SER n 1 47 TYR n 1 48 LYS n 1 49 ALA n 1 50 LEU n 1 51 VAL n 1 52 ALA n 1 53 LEU n 1 54 ARG n 1 55 ARG n 1 56 VAL n 1 57 LEU n 1 58 LEU n 1 59 ALA n 1 60 GLN n 1 61 PHE n 1 62 SER n 1 63 ALA n 1 64 PHE n 1 65 PRO n 1 66 VAL n 1 67 ASN n 1 68 GLY n 1 69 ALA n 1 70 ASP n 1 71 LEU n 1 72 TYR n 1 73 GLU n 1 74 GLU n 1 75 LEU n 1 76 LYS n 1 77 THR n 1 78 SER n 1 79 THR n 1 80 ALA n 1 81 ILE n 1 82 LEU n 1 83 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C9JSQ7_HUMAN _struct_ref.pdbx_db_accession C9JSQ7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTA ILS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KZ3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C9JSQ7 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 83 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 3 '2D 1H-15N HSQC' 1 2 3 '3D 1H-15N NOESY' 1 3 3 '3D 1H-15N TOCSY' 1 4 2 '3D HCCH-TOCSY' 1 5 2 '3D 1H-13C NOESY' 1 6 1 '3D CBCA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HNCO' 1 9 1 '3D H(CCO)NH' 1 10 1 '3D C(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 287 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-100% 15N] human Rad51D_N-1, 1 mM [U-13C; U-15N] human Rad51D_N-2, 1 mM DTT-3, 0.02 % sodium azide-4, 1 mM [U-99% 13C; U-99% 15N] human Rad51D_N-5, 100% D2O ; 1 '100% D2O' '1 mM [U-99% 13C; U-99% 15N] human Rad51D_N-6, 25 mM TRIS-7, 100 mM sodium chloride-8, 1 mM DTT-9, 0.02 % sodium azide-10, 100% D2O' 2 '100% D2O' '1 mM [U-99% 15N] human Rad51D_N-11, 25 mM TRIS-12, 100 mM sodium chloride-13, 1 mM DTT-14, 0.02 % sodium azide-15, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KZ3 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KZ3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KZ3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors 'P.GUNTERT ET AL.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CYANA _pdbx_nmr_software.version 2.1 _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KZ3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KZ3 _struct.title 'Backbone 1H, 13C, and 15N Chemical Shift Assignments for human Rad51D from 1 to 83' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KZ3 _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'Rad51D, Homologous Recombination, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? HIS A 23 ? THR A 13 HIS A 23 1 ? 11 HELX_P HELX_P2 2 THR A 27 ? VAL A 32 ? THR A 27 VAL A 32 1 ? 6 HELX_P HELX_P3 3 ASP A 35 ? GLY A 44 ? ASP A 35 GLY A 44 1 ? 10 HELX_P HELX_P4 4 SER A 46 ? SER A 62 ? SER A 46 SER A 62 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KZ3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 MET 16 16 16 MET MET A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 SER 83 83 83 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'human Rad51D_N-1' 1 ? mM '[U-100% 15N]' 1 'human Rad51D_N-2' 1 ? mM '[U-13C; U-15N]' 1 DTT-3 1 ? mM ? 1 'sodium azide-4' 0.02 ? % ? 1 'human Rad51D_N-5' 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'human Rad51D_N-6' 1 ? mM '[U-99% 13C; U-99% 15N]' 2 TRIS-7 25 ? mM ? 2 'sodium chloride-8' 100 ? mM ? 2 DTT-9 1 ? mM ? 2 'sodium azide-10' 0.02 ? % ? 2 'human Rad51D_N-11' 1 ? mM '[U-99% 15N]' 3 TRIS-12 25 ? mM ? 3 'sodium chloride-13' 100 ? mM ? 3 DTT-14 1 ? mM ? 3 'sodium azide-15' 0.02 ? % ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 10 ? ? -69.74 78.67 2 1 ALA A 34 ? ? -53.23 171.49 3 1 ASP A 35 ? ? -95.25 57.22 4 1 VAL A 66 ? ? -174.66 135.57 5 1 THR A 79 ? ? 37.43 43.50 6 1 ILE A 81 ? ? -67.13 99.55 7 2 ASP A 35 ? ? -98.91 58.64 8 2 PRO A 65 ? ? -69.81 78.81 9 2 GLU A 73 ? ? -102.44 42.26 10 3 ASP A 35 ? ? -93.62 58.33 11 3 ASP A 70 ? ? -173.67 124.65 12 3 SER A 78 ? ? -59.94 -177.75 13 3 ALA A 80 ? ? 62.97 177.11 14 4 ALA A 34 ? ? -55.15 175.51 15 4 ASP A 35 ? ? -97.07 55.11 16 4 ALA A 63 ? ? -106.09 41.22 17 4 PRO A 65 ? ? -69.79 82.50 18 4 SER A 78 ? ? -119.47 69.42 19 5 ARG A 5 ? ? -176.51 -178.55 20 5 ASP A 35 ? ? -109.74 65.11 21 5 VAL A 66 ? ? -170.72 130.89 22 5 THR A 77 ? ? 56.70 72.24 23 5 LEU A 82 ? ? -52.21 -70.09 24 6 ASP A 35 ? ? -104.81 75.34 25 6 PHE A 64 ? ? 62.91 160.60 26 6 PRO A 65 ? ? -69.80 -173.27 27 6 ASP A 70 ? ? -111.25 58.10 28 7 ASP A 35 ? ? -97.98 56.45 29 7 PHE A 64 ? ? 63.12 68.71 30 7 PRO A 65 ? ? -69.77 -171.08 31 8 PRO A 10 ? ? -69.83 87.77 32 8 ALA A 34 ? ? -58.54 177.67 33 8 PHE A 64 ? ? -169.13 73.08 34 8 ASN A 67 ? ? -54.14 172.05 35 9 PRO A 10 ? ? -69.79 92.27 36 9 ALA A 34 ? ? -57.05 176.32 37 9 ASP A 35 ? ? -97.58 57.21 38 9 ALA A 63 ? ? -110.84 60.34 39 9 ASP A 70 ? ? -103.12 78.42 40 9 GLU A 74 ? ? -58.88 99.90 41 9 THR A 79 ? ? -64.26 -177.72 42 9 ILE A 81 ? ? 59.26 94.47 43 10 PRO A 10 ? ? -69.77 88.23 44 10 SER A 62 ? ? -52.09 -71.68 45 10 PHE A 64 ? ? 56.06 71.43 46 10 PRO A 65 ? ? -69.75 79.85 47 10 LEU A 82 ? ? -160.21 88.68 48 11 PRO A 10 ? ? -69.71 84.70 49 11 ALA A 34 ? ? -53.61 172.81 50 11 ASP A 35 ? ? -100.66 62.33 51 11 PRO A 65 ? ? -69.70 94.11 52 11 ALA A 80 ? ? -60.68 -74.37 53 12 ASP A 35 ? ? -95.94 59.45 54 12 ALA A 63 ? ? -52.27 103.27 55 12 PHE A 64 ? ? 63.01 160.55 56 12 ASP A 70 ? ? -161.12 114.48 57 12 ALA A 80 ? ? -92.25 -66.31 58 12 LEU A 82 ? ? -105.94 67.10 59 13 ALA A 34 ? ? -57.61 -179.92 60 13 ASP A 35 ? ? -107.03 62.77 61 13 ALA A 63 ? ? -58.39 -177.14 62 13 ASN A 67 ? ? 63.10 61.59 63 13 ILE A 81 ? ? -84.62 -70.63 64 14 PRO A 10 ? ? -69.77 84.91 65 14 ALA A 34 ? ? -57.77 -178.56 66 14 ASP A 35 ? ? -97.50 57.14 67 14 PHE A 64 ? ? 52.29 71.29 68 15 ASP A 35 ? ? -100.59 61.55 69 15 ASP A 70 ? ? -177.27 114.59 70 15 SER A 78 ? ? -173.04 147.47 71 16 PRO A 10 ? ? -69.68 97.42 72 16 ALA A 34 ? ? -57.46 -179.41 73 16 ASP A 35 ? ? -107.23 62.87 74 17 ARG A 5 ? ? -176.52 -174.81 75 17 ASP A 35 ? ? -105.51 62.45 76 17 PHE A 64 ? ? 58.35 71.03 77 17 PRO A 65 ? ? -69.74 -173.64 78 18 ALA A 34 ? ? -54.75 175.13 79 18 PHE A 64 ? ? 37.15 67.93 80 18 ASP A 70 ? ? -171.14 129.02 81 18 LEU A 71 ? ? -97.88 -71.07 82 19 ALA A 34 ? ? -58.54 175.59 83 19 ASP A 35 ? ? -101.77 58.39 84 19 PRO A 65 ? ? -69.77 -171.80 85 19 SER A 78 ? ? -107.52 42.81 86 19 ILE A 81 ? ? -95.02 -65.38 87 20 LEU A 4 ? ? -50.00 163.13 #