data_2KZ5 # _entry.id 2KZ5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KZ5 pdb_00002kz5 10.2210/pdb2kz5/pdb RCSB RCSB101755 ? ? BMRB 16998 ? ? WWPDB D_1000101755 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16998 BMRB unspecified . HR4653B TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KZ5 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Janjua, H.' 2 'Xiao, R.' 3 'Ciccosanti, C.' 4 'Shastry, R.' 5 'Acton, T.B.' 6 'Tong, S.' 7 'Everett, J.K.' 8 'Montelione, G.T.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target HR4653B' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Janjua, H.' 2 ? primary 'Xiao, R.' 3 ? primary 'Ciccosanti, C.' 4 ? primary 'Shastry, R.' 5 ? primary 'Acton, T.B.' 6 ? primary 'Tong, S.' 7 ? primary 'Everett, J.K.' 8 ? primary 'Montelione, G.T.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcription factor NF-E2 45 kDa subunit' _entity.formula_weight 10567.198 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 214-293' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Nuclear factor, erythroid-derived 2 45 kDa subunit, p45 NF-E2, Leucine zipper protein NF-E2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQN YRKRKLETIVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQN YRKRKLETIVQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR4653B # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 ALA n 1 13 LYS n 1 14 PRO n 1 15 THR n 1 16 ALA n 1 17 ARG n 1 18 GLY n 1 19 GLU n 1 20 ALA n 1 21 GLY n 1 22 SER n 1 23 ARG n 1 24 ASP n 1 25 GLU n 1 26 ARG n 1 27 ARG n 1 28 ALA n 1 29 LEU n 1 30 ALA n 1 31 MET n 1 32 LYS n 1 33 ILE n 1 34 PRO n 1 35 PHE n 1 36 PRO n 1 37 THR n 1 38 ASP n 1 39 LYS n 1 40 ILE n 1 41 VAL n 1 42 ASN n 1 43 LEU n 1 44 PRO n 1 45 VAL n 1 46 ASP n 1 47 ASP n 1 48 PHE n 1 49 ASN n 1 50 GLU n 1 51 LEU n 1 52 LEU n 1 53 ALA n 1 54 ARG n 1 55 TYR n 1 56 PRO n 1 57 LEU n 1 58 THR n 1 59 GLU n 1 60 SER n 1 61 GLN n 1 62 LEU n 1 63 ALA n 1 64 LEU n 1 65 VAL n 1 66 ARG n 1 67 ASP n 1 68 ILE n 1 69 ARG n 1 70 ARG n 1 71 ARG n 1 72 GLY n 1 73 LYS n 1 74 ASN n 1 75 LYS n 1 76 VAL n 1 77 ALA n 1 78 ALA n 1 79 GLN n 1 80 ASN n 1 81 TYR n 1 82 ARG n 1 83 LYS n 1 84 ARG n 1 85 LYS n 1 86 LEU n 1 87 GLU n 1 88 THR n 1 89 ILE n 1 90 VAL n 1 91 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NFE2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 14-15C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NFE2_HUMAN _struct_ref.pdbx_db_accession Q16621 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQ ; _struct_ref.pdbx_align_begin 214 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KZ5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 12 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 91 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q16621 _struct_ref_seq.db_align_beg 214 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 293 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 12 _struct_ref_seq.pdbx_auth_seq_align_end 91 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KZ5 MET A 1 ? UNP Q16621 ? ? 'expression tag' 1 1 1 2KZ5 GLY A 2 ? UNP Q16621 ? ? 'expression tag' 2 2 1 2KZ5 HIS A 3 ? UNP Q16621 ? ? 'expression tag' 3 3 1 2KZ5 HIS A 4 ? UNP Q16621 ? ? 'expression tag' 4 4 1 2KZ5 HIS A 5 ? UNP Q16621 ? ? 'expression tag' 5 5 1 2KZ5 HIS A 6 ? UNP Q16621 ? ? 'expression tag' 6 6 1 2KZ5 HIS A 7 ? UNP Q16621 ? ? 'expression tag' 7 7 1 2KZ5 HIS A 8 ? UNP Q16621 ? ? 'expression tag' 8 8 1 2KZ5 SER A 9 ? UNP Q16621 ? ? 'expression tag' 9 9 1 2KZ5 HIS A 10 ? UNP Q16621 ? ? 'expression tag' 10 10 1 2KZ5 MET A 11 ? UNP Q16621 ? ? 'expression tag' 11 11 1 2KZ5 TYR A 81 ? UNP Q16621 CYS 283 conflict 81 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '3D C(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.0 mM [U-100% 13C; U-100% 15N] HR4653B, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1.1 mM [U-10% 13C; U-100% 15N] HR4653B, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KZ5 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KZ5 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KZ5 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 7 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 9 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 10 'Bartels et al.' 'data analysis' XEASY ? 11 'Bartels et al.' 'peak picking' XEASY ? 12 'Bartels et al.' 'chemical shift assignment' XEASY ? 13 'Bruker Biospin' collection TopSpin ? 14 Varian collection VnmrJ ? 15 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 16 Goddard 'data analysis' Sparky ? 17 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 18 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 19 'Valafar, Prestegard' 'geometry optimization' REDCAT ? 20 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KZ5 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KZ5 _struct.title ;Solution NMR Structure of Transcription factor NF-E2 subunit's DNA binding domain from Homo sapiens, Northeast Structural Genomics Consortium Target HR4653B ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KZ5 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, TRANSCRIPTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 22 ? LYS A 32 ? SER A 22 LYS A 32 1 ? 11 HELX_P HELX_P2 2 PRO A 36 ? LEU A 43 ? PRO A 36 LEU A 43 1 ? 8 HELX_P HELX_P3 3 PRO A 44 ? TYR A 55 ? PRO A 44 TYR A 55 1 ? 12 HELX_P HELX_P4 4 THR A 58 ? ALA A 78 ? THR A 58 ALA A 78 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2KZ5 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLN 91 91 91 GLN GLN A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-07-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 4 'Structure model' struct_ref # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 4 'Structure model' '_struct_ref.pdbx_seq_one_letter_code' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR4653B-1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 1 HR4653B-2 1.1 ? mM '[U-10% 13C; U-100% 15N]' 2 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 13 _pdbx_validate_close_contact.auth_atom_id_1 HB3 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 24 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH22 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 71 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.23 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 32 ? ? 62.68 62.92 2 1 PRO A 56 ? ? -67.62 83.85 3 1 GLU A 87 ? ? -52.21 96.90 4 2 ALA A 20 ? ? 179.16 142.22 5 3 LYS A 32 ? ? 56.64 74.53 6 3 PRO A 34 ? ? -76.45 24.96 7 3 GLU A 87 ? ? -64.90 95.97 8 3 ILE A 89 ? ? -58.46 103.23 9 4 HIS A 6 ? ? -172.17 130.50 10 4 LYS A 32 ? ? 76.32 63.66 11 4 PRO A 44 ? ? -68.45 -178.56 12 5 HIS A 7 ? ? -69.47 94.99 13 5 SER A 9 ? ? -62.72 91.71 14 5 LYS A 13 ? ? 68.52 132.19 15 5 LYS A 32 ? ? 58.90 71.90 16 5 PRO A 34 ? ? -79.94 25.58 17 5 PRO A 56 ? ? -77.85 43.65 18 5 GLU A 87 ? ? -66.95 92.12 19 6 ALA A 12 ? ? 69.24 83.60 20 6 LYS A 32 ? ? 63.84 72.16 21 6 PRO A 56 ? ? -66.39 81.57 22 6 ASN A 80 ? ? -145.97 27.76 23 7 SER A 9 ? ? -169.08 105.92 24 7 LYS A 13 ? ? 62.36 79.92 25 7 THR A 15 ? ? -61.09 97.33 26 7 LYS A 32 ? ? 61.71 78.01 27 7 PRO A 56 ? ? -75.87 42.49 28 7 ARG A 82 ? ? 67.66 64.56 29 8 LYS A 32 ? ? 66.34 93.94 30 8 LEU A 86 ? ? -66.46 85.90 31 9 HIS A 6 ? ? -108.83 -80.30 32 9 HIS A 10 ? ? -154.46 21.15 33 9 LYS A 32 ? ? 53.65 74.20 34 9 VAL A 76 ? ? -91.39 33.01 35 9 LYS A 83 ? ? 68.87 -0.76 36 9 LEU A 86 ? ? -67.02 -179.93 37 9 ILE A 89 ? ? -66.08 99.26 38 10 HIS A 7 ? ? -161.17 119.00 39 10 LYS A 32 ? ? 64.60 84.10 40 10 PRO A 34 ? ? -76.35 24.85 41 10 PRO A 56 ? ? -67.47 89.61 42 11 THR A 15 ? ? -135.23 -72.43 43 11 ALA A 16 ? ? -57.56 102.54 44 11 LEU A 86 ? ? -101.07 71.61 45 12 HIS A 4 ? ? -69.12 98.20 46 12 HIS A 10 ? ? -165.14 119.89 47 12 SER A 22 ? ? 177.75 153.07 48 12 GLU A 87 ? ? -76.46 -164.07 49 13 HIS A 10 ? ? -93.05 -69.66 50 13 LYS A 13 ? ? 65.21 137.36 51 13 ARG A 82 ? ? -59.29 97.71 52 14 HIS A 7 ? ? -154.67 34.92 53 14 LYS A 32 ? ? 71.57 89.39 54 14 LYS A 85 ? ? 65.37 73.31 55 15 ALA A 16 ? ? -97.26 32.16 56 15 ALA A 20 ? ? -172.19 -174.43 57 15 PRO A 56 ? ? -76.81 46.91 58 16 GLU A 19 ? ? -169.25 -36.70 59 16 PRO A 56 ? ? -75.87 43.40 60 16 GLU A 87 ? ? -66.70 84.62 61 16 ILE A 89 ? ? 72.14 -33.10 62 17 HIS A 6 ? ? -69.12 84.71 63 17 LYS A 13 ? ? 56.17 98.53 64 17 ALA A 20 ? ? 76.09 138.66 65 17 PRO A 56 ? ? -65.43 90.16 66 17 ARG A 82 ? ? -68.06 86.36 67 17 THR A 88 ? ? 49.05 29.11 68 18 ALA A 12 ? ? -79.95 25.28 69 18 GLU A 19 ? ? 67.41 95.00 70 18 LYS A 32 ? ? 58.46 72.19 71 18 PRO A 34 ? ? -77.13 20.61 72 18 PRO A 56 ? ? -77.89 47.61 73 18 LYS A 85 ? ? -68.63 80.17 74 19 PRO A 14 ? ? -48.34 164.03 75 19 PRO A 34 ? ? -83.06 30.19 76 19 ARG A 84 ? ? 51.59 109.75 77 19 GLU A 87 ? ? -64.82 97.21 78 20 HIS A 7 ? ? 80.39 -55.00 79 20 HIS A 8 ? ? -55.15 104.64 80 20 LYS A 32 ? ? 61.73 82.04 81 20 VAL A 90 ? ? -69.87 99.55 #