data_2KZ6 # _entry.id 2KZ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KZ6 RCSB RCSB101756 WWPDB D_1000101756 BMRB 16999 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB CvT2 . unspecified BMRB 16999 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KZ6 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Yee, A.' 2 'Lee, H.' 3 'Semesi, A.' 4 'Prestegard, J.' 5 'Montelione, G.T.' 6 'Arrowsmith, C.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 # _citation.id primary _citation.title 'Solution structure of protein CV0426 from Chromobacterium violaceum' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lemak, A.' 1 ? primary 'Yee, A.' 2 ? primary 'Lee, H.' 3 ? primary 'Semesi, A.' 4 ? primary 'Prestegard, J.' 5 ? primary 'Montelione, G.T.' 6 ? primary 'Arrowsmith, C.' 7 ? # _cell.entry_id 2KZ6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KZ6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 11612.074 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QGMLLHSVETPRGEILNVSEQEARDVFGASEQAIADARKATILQTLRIERDERLRACDWTQVQDVVLTADQKATWAKYRQ ALRDLPETVTDLSQIVWPQLPV ; _entity_poly.pdbx_seq_one_letter_code_can ;QGMLLHSVETPRGEILNVSEQEARDVFGASEQAIADARKATILQTLRIERDERLRACDWTQVQDVVLTADQKATWAKYRQ ALRDLPETVTDLSQIVWPQLPV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier CvT2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 GLY n 1 3 MET n 1 4 LEU n 1 5 LEU n 1 6 HIS n 1 7 SER n 1 8 VAL n 1 9 GLU n 1 10 THR n 1 11 PRO n 1 12 ARG n 1 13 GLY n 1 14 GLU n 1 15 ILE n 1 16 LEU n 1 17 ASN n 1 18 VAL n 1 19 SER n 1 20 GLU n 1 21 GLN n 1 22 GLU n 1 23 ALA n 1 24 ARG n 1 25 ASP n 1 26 VAL n 1 27 PHE n 1 28 GLY n 1 29 ALA n 1 30 SER n 1 31 GLU n 1 32 GLN n 1 33 ALA n 1 34 ILE n 1 35 ALA n 1 36 ASP n 1 37 ALA n 1 38 ARG n 1 39 LYS n 1 40 ALA n 1 41 THR n 1 42 ILE n 1 43 LEU n 1 44 GLN n 1 45 THR n 1 46 LEU n 1 47 ARG n 1 48 ILE n 1 49 GLU n 1 50 ARG n 1 51 ASP n 1 52 GLU n 1 53 ARG n 1 54 LEU n 1 55 ARG n 1 56 ALA n 1 57 CYS n 1 58 ASP n 1 59 TRP n 1 60 THR n 1 61 GLN n 1 62 VAL n 1 63 GLN n 1 64 ASP n 1 65 VAL n 1 66 VAL n 1 67 LEU n 1 68 THR n 1 69 ALA n 1 70 ASP n 1 71 GLN n 1 72 LYS n 1 73 ALA n 1 74 THR n 1 75 TRP n 1 76 ALA n 1 77 LYS n 1 78 TYR n 1 79 ARG n 1 80 GLN n 1 81 ALA n 1 82 LEU n 1 83 ARG n 1 84 ASP n 1 85 LEU n 1 86 PRO n 1 87 GLU n 1 88 THR n 1 89 VAL n 1 90 THR n 1 91 ASP n 1 92 LEU n 1 93 SER n 1 94 GLN n 1 95 ILE n 1 96 VAL n 1 97 TRP n 1 98 PRO n 1 99 GLN n 1 100 LEU n 1 101 PRO n 1 102 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CV_0426 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chromobacterium violaceum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 536 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'p15Tv lic' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7P0Y9_CHRVO _struct_ref.pdbx_db_accession Q7P0Y9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLLHSVQTPRGEILNVSEQEARDVFGASEQAIADARKATILQTLRIERDERLRACDWTQVQDVVLTADQKATWAKYRQAL RDLPETVTDLSQIVWPQLPV ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KZ6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7P0Y9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KZ6 GLN A 1 ? UNP Q7P0Y9 ? ? 'expression tag' -1 1 1 2KZ6 GLY A 2 ? UNP Q7P0Y9 ? ? 'expression tag' 0 2 1 2KZ6 GLU A 9 ? UNP Q7P0Y9 GLN 7 'SEE REMARK 999' 7 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D 1H-13C_arom NOESY' 1 10 1 '2D 1H-15N HSQC (IPAP)' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;0.5 mM [U-13C; U-15N] cv0426-1, 10 mM MOPS-2, 450 mM sodium chloride-3, 10 uM ZnSO4-4, 10 mM DTT-5, 0.01 % NaN3-6, 10 mM benzamidine-7, 10 % D2O-8, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2KZ6 _pdbx_nmr_refine.method 'restrained molecular dynamics' _pdbx_nmr_refine.details 'refinment in water bath with RDC restraints' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KZ6 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KZ6 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'peak picking' Sparky ? 2 'Lemak, Steren, Llinas, Arrowsmith' 'chemical shift assignment' FMC ? 3 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE ? 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KZ6 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KZ6 _struct.title 'Solution structure of protein CV0426 from Chromobacterium violaceum, Northeast structural genomics consortium (NESG) target CVT2' _struct.pdbx_descriptor 'Uncharacterized protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KZ6 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;protein of unknown function, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 19 ? VAL A 26 ? SER A 17 VAL A 24 1 ? 8 HELX_P HELX_P2 2 SER A 30 ? CYS A 57 ? SER A 28 CYS A 55 1 ? 28 HELX_P HELX_P3 3 CYS A 57 ? VAL A 62 ? CYS A 55 VAL A 60 1 ? 6 HELX_P HELX_P4 4 THR A 68 ? LEU A 85 ? THR A 66 LEU A 83 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 5 ? THR A 10 ? LEU A 3 THR A 8 A 2 GLY A 13 ? VAL A 18 ? GLY A 11 VAL A 16 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 5 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 3 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 18 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 16 # _atom_sites.entry_id 2KZ6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 -1 ? ? ? A . n A 1 2 GLY 2 0 ? ? ? A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 LEU 4 2 2 LEU LEU A . n A 1 5 LEU 5 3 3 LEU LEU A . n A 1 6 HIS 6 4 4 HIS HIS A . n A 1 7 SER 7 5 5 SER SER A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 GLU 9 7 7 GLU GLU A . n A 1 10 THR 10 8 8 THR THR A . n A 1 11 PRO 11 9 9 PRO PRO A . n A 1 12 ARG 12 10 10 ARG ARG A . n A 1 13 GLY 13 11 11 GLY GLY A . n A 1 14 GLU 14 12 12 GLU GLU A . n A 1 15 ILE 15 13 13 ILE ILE A . n A 1 16 LEU 16 14 14 LEU LEU A . n A 1 17 ASN 17 15 15 ASN ASN A . n A 1 18 VAL 18 16 16 VAL VAL A . n A 1 19 SER 19 17 17 SER SER A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 GLN 21 19 19 GLN GLN A . n A 1 22 GLU 22 20 20 GLU GLU A . n A 1 23 ALA 23 21 21 ALA ALA A . n A 1 24 ARG 24 22 22 ARG ARG A . n A 1 25 ASP 25 23 23 ASP ASP A . n A 1 26 VAL 26 24 24 VAL VAL A . n A 1 27 PHE 27 25 25 PHE PHE A . n A 1 28 GLY 28 26 26 GLY GLY A . n A 1 29 ALA 29 27 27 ALA ALA A . n A 1 30 SER 30 28 28 SER SER A . n A 1 31 GLU 31 29 29 GLU GLU A . n A 1 32 GLN 32 30 30 GLN GLN A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 ILE 34 32 32 ILE ILE A . n A 1 35 ALA 35 33 33 ALA ALA A . n A 1 36 ASP 36 34 34 ASP ASP A . n A 1 37 ALA 37 35 35 ALA ALA A . n A 1 38 ARG 38 36 36 ARG ARG A . n A 1 39 LYS 39 37 37 LYS LYS A . n A 1 40 ALA 40 38 38 ALA ALA A . n A 1 41 THR 41 39 39 THR THR A . n A 1 42 ILE 42 40 40 ILE ILE A . n A 1 43 LEU 43 41 41 LEU LEU A . n A 1 44 GLN 44 42 42 GLN GLN A . n A 1 45 THR 45 43 43 THR THR A . n A 1 46 LEU 46 44 44 LEU LEU A . n A 1 47 ARG 47 45 45 ARG ARG A . n A 1 48 ILE 48 46 46 ILE ILE A . n A 1 49 GLU 49 47 47 GLU GLU A . n A 1 50 ARG 50 48 48 ARG ARG A . n A 1 51 ASP 51 49 49 ASP ASP A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 ARG 53 51 51 ARG ARG A . n A 1 54 LEU 54 52 52 LEU LEU A . n A 1 55 ARG 55 53 53 ARG ARG A . n A 1 56 ALA 56 54 54 ALA ALA A . n A 1 57 CYS 57 55 55 CYS CYS A . n A 1 58 ASP 58 56 56 ASP ASP A . n A 1 59 TRP 59 57 57 TRP TRP A . n A 1 60 THR 60 58 58 THR THR A . n A 1 61 GLN 61 59 59 GLN GLN A . n A 1 62 VAL 62 60 60 VAL VAL A . n A 1 63 GLN 63 61 61 GLN GLN A . n A 1 64 ASP 64 62 62 ASP ASP A . n A 1 65 VAL 65 63 63 VAL VAL A . n A 1 66 VAL 66 64 64 VAL VAL A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 THR 68 66 66 THR THR A . n A 1 69 ALA 69 67 67 ALA ALA A . n A 1 70 ASP 70 68 68 ASP ASP A . n A 1 71 GLN 71 69 69 GLN GLN A . n A 1 72 LYS 72 70 70 LYS LYS A . n A 1 73 ALA 73 71 71 ALA ALA A . n A 1 74 THR 74 72 72 THR THR A . n A 1 75 TRP 75 73 73 TRP TRP A . n A 1 76 ALA 76 74 74 ALA ALA A . n A 1 77 LYS 77 75 75 LYS LYS A . n A 1 78 TYR 78 76 76 TYR TYR A . n A 1 79 ARG 79 77 77 ARG ARG A . n A 1 80 GLN 80 78 78 GLN GLN A . n A 1 81 ALA 81 79 79 ALA ALA A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 ARG 83 81 81 ARG ARG A . n A 1 84 ASP 84 82 82 ASP ASP A . n A 1 85 LEU 85 83 83 LEU LEU A . n A 1 86 PRO 86 84 84 PRO PRO A . n A 1 87 GLU 87 85 85 GLU GLU A . n A 1 88 THR 88 86 86 THR THR A . n A 1 89 VAL 89 87 87 VAL VAL A . n A 1 90 THR 90 88 88 THR THR A . n A 1 91 ASP 91 89 89 ASP ASP A . n A 1 92 LEU 92 90 90 LEU LEU A . n A 1 93 SER 93 91 91 SER SER A . n A 1 94 GLN 94 92 92 GLN GLN A . n A 1 95 ILE 95 93 93 ILE ILE A . n A 1 96 VAL 96 94 94 VAL VAL A . n A 1 97 TRP 97 95 95 TRP TRP A . n A 1 98 PRO 98 96 96 PRO PRO A . n A 1 99 GLN 99 97 97 GLN GLN A . n A 1 100 LEU 100 98 98 LEU LEU A . n A 1 101 PRO 101 99 99 PRO PRO A . n A 1 102 VAL 102 100 100 VAL VAL A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-06-30 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Experimental preparation' 6 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_sample_details 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_assembly 7 3 'Structure model' pdbx_struct_oper_list 8 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_sample_details.contents' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_entry_details.entry_id 2KZ6 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE SEQUENCE PROVIDED IS THE TRANSLATED PLASMID SEQUENCE OBTAINED FROM CHROMOBACTERIUM VIOLACEUM ATCC 12472 GENOMIC DNA CLONING. THE SEQUENCE OF THE PROTEIN THAT WAS SOLVED HAS GLUTAMIC ACID IN RESIDUE 7 AND NOT GLUTAMINE. ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id cv0426-1 0.5 ? mM '[U-13C; U-15N]' 1 MOPS-2 10 ? mM ? 1 'sodium chloride-3' 450 ? mM ? 1 ZnSO4-4 10 ? uM ? 1 DTT-5 10 ? mM ? 1 NaN3-6 0.01 ? % ? 1 benzamidine-7 10 ? mM ? 1 D2O-8 10 ? % ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -163.93 117.79 2 1 ASN A 15 ? ? 52.24 87.77 3 1 GLU A 85 ? ? -62.03 95.77 4 1 THR A 88 ? ? 57.01 80.74 5 1 GLN A 92 ? ? -59.50 107.38 6 2 ASN A 15 ? ? 61.52 73.88 7 2 VAL A 87 ? ? -111.61 -164.51 8 3 ASN A 15 ? ? 51.91 78.20 9 3 ASP A 89 ? ? -157.71 -83.36 10 4 ASN A 15 ? ? 63.35 88.91 11 4 LEU A 90 ? ? 177.31 -172.49 12 5 ASN A 15 ? ? 37.52 79.20 13 5 THR A 88 ? ? -170.68 144.23 14 6 ASN A 15 ? ? 60.06 86.35 15 6 SER A 91 ? ? -64.57 -70.66 16 7 ASN A 15 ? ? 65.05 87.23 17 7 THR A 88 ? ? 45.77 80.99 18 8 SER A 5 ? ? -165.26 95.08 19 8 ASN A 15 ? ? 31.76 72.59 20 9 ASN A 15 ? ? 65.41 77.81 21 9 THR A 88 ? ? -78.71 -164.13 22 9 SER A 91 ? ? -163.29 100.44 23 10 SER A 5 ? ? -165.90 109.85 24 10 PRO A 84 ? ? -32.28 112.76 25 10 THR A 86 ? ? 60.45 82.65 26 11 ASN A 15 ? ? 52.78 84.64 27 11 GLU A 85 ? ? -68.41 85.74 28 11 THR A 86 ? ? -67.06 82.59 29 12 SER A 5 ? ? -165.58 102.12 30 12 ASN A 15 ? ? 64.10 80.47 31 12 GLU A 85 ? ? -61.82 91.75 32 12 THR A 86 ? ? -65.59 91.63 33 12 THR A 88 ? ? 57.66 -59.60 34 12 ASP A 89 ? ? -56.66 99.16 35 12 SER A 91 ? ? -144.44 -50.60 36 13 HIS A 4 ? ? -39.76 -36.17 37 13 ASN A 15 ? ? 39.52 82.31 38 14 CYS A 55 ? ? -94.91 34.45 39 15 THR A 86 ? ? 55.24 9.69 40 15 SER A 91 ? ? -139.14 -63.44 41 15 GLN A 92 ? ? -172.52 111.13 42 15 ILE A 93 ? ? -64.38 87.29 43 16 ASN A 15 ? ? 43.85 74.28 44 16 VAL A 87 ? ? 60.62 68.80 45 16 ASP A 89 ? ? -101.26 -166.67 46 16 GLN A 92 ? ? 59.75 81.36 47 17 ASN A 15 ? ? 66.68 89.03 48 17 GLN A 61 ? ? 51.81 19.69 49 17 VAL A 87 ? ? 60.51 84.70 50 18 ASN A 15 ? ? 68.09 76.83 51 18 GLU A 85 ? ? -85.15 47.16 52 19 ASN A 15 ? ? 38.35 68.41 53 19 LEU A 90 ? ? -54.10 100.64 54 20 ASN A 15 ? ? 57.20 74.77 55 20 PRO A 84 ? ? -69.65 97.46 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN -1 ? A GLN 1 2 1 Y 1 A GLY 0 ? A GLY 2 3 2 Y 1 A GLN -1 ? A GLN 1 4 2 Y 1 A GLY 0 ? A GLY 2 5 3 Y 1 A GLN -1 ? A GLN 1 6 3 Y 1 A GLY 0 ? A GLY 2 7 4 Y 1 A GLN -1 ? A GLN 1 8 4 Y 1 A GLY 0 ? A GLY 2 9 5 Y 1 A GLN -1 ? A GLN 1 10 5 Y 1 A GLY 0 ? A GLY 2 11 6 Y 1 A GLN -1 ? A GLN 1 12 6 Y 1 A GLY 0 ? A GLY 2 13 7 Y 1 A GLN -1 ? A GLN 1 14 7 Y 1 A GLY 0 ? A GLY 2 15 8 Y 1 A GLN -1 ? A GLN 1 16 8 Y 1 A GLY 0 ? A GLY 2 17 9 Y 1 A GLN -1 ? A GLN 1 18 9 Y 1 A GLY 0 ? A GLY 2 19 10 Y 1 A GLN -1 ? A GLN 1 20 10 Y 1 A GLY 0 ? A GLY 2 21 11 Y 1 A GLN -1 ? A GLN 1 22 11 Y 1 A GLY 0 ? A GLY 2 23 12 Y 1 A GLN -1 ? A GLN 1 24 12 Y 1 A GLY 0 ? A GLY 2 25 13 Y 1 A GLN -1 ? A GLN 1 26 13 Y 1 A GLY 0 ? A GLY 2 27 14 Y 1 A GLN -1 ? A GLN 1 28 14 Y 1 A GLY 0 ? A GLY 2 29 15 Y 1 A GLN -1 ? A GLN 1 30 15 Y 1 A GLY 0 ? A GLY 2 31 16 Y 1 A GLN -1 ? A GLN 1 32 16 Y 1 A GLY 0 ? A GLY 2 33 17 Y 1 A GLN -1 ? A GLN 1 34 17 Y 1 A GLY 0 ? A GLY 2 35 18 Y 1 A GLN -1 ? A GLN 1 36 18 Y 1 A GLY 0 ? A GLY 2 37 19 Y 1 A GLN -1 ? A GLN 1 38 19 Y 1 A GLY 0 ? A GLY 2 39 20 Y 1 A GLN -1 ? A GLN 1 40 20 Y 1 A GLY 0 ? A GLY 2 #