data_2KZW # _entry.id 2KZW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KZW pdb_00002kzw 10.2210/pdb2kzw/pdb RCSB RCSB101781 ? ? BMRB 17021 ? ? WWPDB D_1000101781 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17021 BMRB unspecified . MaR143A TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KZW _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-25 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mills, J.L.' 1 'Eletsky, A.' 2 'Lee, H.' 3 'Lee, D.' 4 'Ciccosanti, C.' 5 'Hamilton, K.' 6 'Acton, T.B.' 7 'Xiao, R.' 8 'Everett, J.K.' 9 'Prestegard, J.H.' 10 'Montelione, G.T.' 11 'Szyperski, T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target MaR143A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mills, J.L.' 1 ? primary 'Eletsky, A.' 2 ? primary 'Lee, H.' 3 ? primary 'Lee, D.' 4 ? primary 'Ciccosanti, C.' 5 ? primary 'Hamilton, K.' 6 ? primary 'Acton, T.B.' 7 ? primary 'Xiao, R.' 8 ? primary 'Everett, J.K.' 9 ? primary 'Prestegard, J.H.' 10 ? primary 'Montelione, G.T.' 11 ? primary 'Szyperski, T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 16271.438 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNARDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPTARFTSDITEGFAPLSVR FKDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVSNENDSDSASVTIRALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNARDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPTARFTSDITEGFAPLSVR FKDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVSNENDSDSASVTIRALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MaR143A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ALA n 1 4 ARG n 1 5 ASP n 1 6 ASN n 1 7 LYS n 1 8 PHE n 1 9 ASN n 1 10 THR n 1 11 TRP n 1 12 ASN n 1 13 ASP n 1 14 SER n 1 15 ARG n 1 16 GLY n 1 17 ASN n 1 18 TYR n 1 19 TRP n 1 20 SER n 1 21 ASP n 1 22 TYR n 1 23 GLU n 1 24 GLY n 1 25 SER n 1 26 ASP n 1 27 GLU n 1 28 ASN n 1 29 GLY n 1 30 ASP n 1 31 GLY n 1 32 ILE n 1 33 GLY n 1 34 ASP n 1 35 SER n 1 36 ALA n 1 37 TYR n 1 38 ALA n 1 39 VAL n 1 40 ASN n 1 41 PRO n 1 42 GLU n 1 43 ALA n 1 44 GLY n 1 45 SER n 1 46 MET n 1 47 ASP n 1 48 TYR n 1 49 MET n 1 50 PRO n 1 51 LEU n 1 52 MET n 1 53 GLU n 1 54 TYR n 1 55 LEU n 1 56 HIS n 1 57 SER n 1 58 SER n 1 59 PRO n 1 60 VAL n 1 61 LEU n 1 62 PRO n 1 63 THR n 1 64 ALA n 1 65 ARG n 1 66 PHE n 1 67 THR n 1 68 SER n 1 69 ASP n 1 70 ILE n 1 71 THR n 1 72 GLU n 1 73 GLY n 1 74 PHE n 1 75 ALA n 1 76 PRO n 1 77 LEU n 1 78 SER n 1 79 VAL n 1 80 ARG n 1 81 PHE n 1 82 LYS n 1 83 ASP n 1 84 PHE n 1 85 SER n 1 86 GLU n 1 87 ASN n 1 88 ALA n 1 89 THR n 1 90 SER n 1 91 ARG n 1 92 LEU n 1 93 TRP n 1 94 MET n 1 95 PHE n 1 96 GLY n 1 97 ASP n 1 98 GLY n 1 99 ASN n 1 100 THR n 1 101 SER n 1 102 ASP n 1 103 SER n 1 104 PRO n 1 105 SER n 1 106 PRO n 1 107 LEU n 1 108 HIS n 1 109 THR n 1 110 PHE n 1 111 PHE n 1 112 ASN n 1 113 GLU n 1 114 GLY n 1 115 GLU n 1 116 TYR n 1 117 ILE n 1 118 VAL n 1 119 SER n 1 120 LEU n 1 121 ILE n 1 122 VAL n 1 123 SER n 1 124 ASN n 1 125 GLU n 1 126 ASN n 1 127 ASP n 1 128 SER n 1 129 ASP n 1 130 SER n 1 131 ALA n 1 132 SER n 1 133 VAL n 1 134 THR n 1 135 ILE n 1 136 ARG n 1 137 ALA n 1 138 LEU n 1 139 GLU n 1 140 HIS n 1 141 HIS n 1 142 HIS n 1 143 HIS n 1 144 HIS n 1 145 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MM_3178 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanosarcina mazei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2209 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8PSA4_METMA _struct_ref.pdbx_db_accession Q8PSA4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NARDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPTARFTSDITEGFAPLSVRF KDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVSNENDSDSASVTIRAL ; _struct_ref.pdbx_align_begin 179 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KZW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 138 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8PSA4 _struct_ref_seq.db_align_beg 179 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 315 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 138 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KZW MET A 1 ? UNP Q8PSA4 ? ? 'initiating methionine' 1 1 1 2KZW GLU A 139 ? UNP Q8PSA4 ? ? 'expression tag' 139 2 1 2KZW HIS A 140 ? UNP Q8PSA4 ? ? 'expression tag' 140 3 1 2KZW HIS A 141 ? UNP Q8PSA4 ? ? 'expression tag' 141 4 1 2KZW HIS A 142 ? UNP Q8PSA4 ? ? 'expression tag' 142 5 1 2KZW HIS A 143 ? UNP Q8PSA4 ? ? 'expression tag' 143 6 1 2KZW HIS A 144 ? UNP Q8PSA4 ? ? 'expression tag' 144 7 1 2KZW HIS A 145 ? UNP Q8PSA4 ? ? 'expression tag' 145 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 3 '2D 1H-15N HSQC' 1 9 2 '2D 1H-13C HSQC' 1 10 1 '3D HCCH-TOCSY' 1 11 1 '3D HCCH-COSY' 1 12 1 'HB(CBCGCDCE)HE' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.55 mM [U-100% 13C; U-100% 15N] MaR143A, 100 mM sodium chloride, 5 mM DTT, 0.02 % sodium azide, 10 mM TRIS, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.55 mM [U-5% 13C; U-100% 15N] MaR143A, 100 mM sodium chloride, 5 mM DTT, 0.02 % sodium azide, 10 mM TRIS, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' ;0.55 mM [U-5% 13C; U-100% 15N] MaR143A, 100 mM sodium chloride, 5 mM DTT, 0.02 % sodium azide, 10 mM TRIS, 13 mg/mL Pf1 phage, 95% H2O/5% D2O ; 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 750 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KZW _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KZW _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KZW _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'tructure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 7 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 9 Guntert processing PROSA ? 10 'Keller et al.' 'data analysis,peak picking,chemical shift assignment' CARA 1.8 11 'Bruker Biospin' collection TopSpin ? 12 Varian collection VnmrJ ? 13 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 14 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 15 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 16 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KZW _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KZW _struct.title 'Solution NMR Structure of Q8PSA4 from Methanosarcina mazei, Northeast Structural Genomics Consortium Target MaR143A' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KZW _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown function' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, Unknown function' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 4 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 66 ? THR A 67 ? PHE A 66 THR A 67 A 2 LYS A 82 ? ASP A 83 ? LYS A 82 ASP A 83 B 1 GLU A 72 ? PHE A 74 ? GLU A 72 PHE A 74 B 2 SER A 128 ? LEU A 138 ? SER A 128 LEU A 138 B 3 GLY A 114 ? SER A 123 ? GLY A 114 SER A 123 B 4 SER A 90 ? TRP A 93 ? SER A 90 TRP A 93 C 1 VAL A 79 ? ARG A 80 ? VAL A 79 ARG A 80 C 2 LEU A 107 ? HIS A 108 ? LEU A 107 HIS A 108 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 67 ? N THR A 67 O LYS A 82 ? O LYS A 82 B 1 2 N GLY A 73 ? N GLY A 73 O LEU A 138 ? O LEU A 138 B 2 3 O ASP A 129 ? O ASP A 129 N VAL A 122 ? N VAL A 122 B 3 4 O ILE A 121 ? O ILE A 121 N LEU A 92 ? N LEU A 92 C 1 2 N VAL A 79 ? N VAL A 79 O HIS A 108 ? O HIS A 108 # _atom_sites.entry_id 2KZW _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 MET 49 49 49 MET MET A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 MET 52 52 52 MET MET A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 TRP 93 93 93 TRP TRP A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 ASP 129 129 129 ASP ASP A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ARG 136 136 136 ARG ARG A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 HIS 142 142 142 HIS HIS A . n A 1 143 HIS 143 143 143 HIS HIS A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 HIS 145 145 145 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-03-07 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Structure summary' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' struct_ref_seq_dif 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_struct_ref_seq_dif.details' 5 5 'Structure model' '_database_2.pdbx_DOI' 6 5 'Structure model' '_database_2.pdbx_database_accession' 7 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MaR143A-1 0.55 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-2' 100 ? mM ? 1 DTT-3 5 ? mM ? 1 'sodium azide-4' 0.02 ? % ? 1 TRIS-5 10 ? mM ? 1 MaR143A-6 0.55 ? mM '[U-5% 13C; U-100% 15N]' 2 'sodium chloride-7' 100 ? mM ? 2 DTT-8 5 ? mM ? 2 'sodium azide-9' 0.02 ? % ? 2 TRIS-10 10 ? mM ? 2 MaR143A-11 0.55 ? mM '[U-5% 13C; U-100% 15N]' 3 'sodium chloride-12' 100 ? mM ? 3 DTT-13 5 ? mM ? 3 'sodium azide-14' 0.02 ? % ? 3 TRIS-15 10 ? mM ? 3 'Pf1 phage-16' 13 ? mg/mL ? 3 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 7 _pdbx_validate_close_contact.auth_atom_id_1 HA _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 80 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HB3 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 PRO _pdbx_validate_close_contact.auth_seq_id_2 106 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.26 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 41 ? ? -66.41 -73.42 2 1 SER A 101 ? ? 63.90 -47.56 3 2 ARG A 4 ? ? -105.55 44.84 4 2 GLU A 27 ? ? -87.98 -82.95 5 2 GLU A 42 ? ? 66.98 -95.00 6 2 SER A 78 ? ? 60.94 100.85 7 2 PRO A 106 ? ? -81.80 42.14 8 3 GLU A 23 ? ? -104.67 73.80 9 3 GLU A 42 ? ? -78.97 -86.83 10 3 ASP A 47 ? ? 62.47 91.43 11 3 ALA A 75 ? ? -55.50 109.28 12 3 SER A 101 ? ? 58.19 99.93 13 3 PRO A 106 ? ? -60.33 98.53 14 4 GLU A 23 ? ? -116.25 -72.75 15 4 LEU A 77 ? ? -86.01 -76.64 16 4 SER A 101 ? ? 66.57 -80.40 17 5 TRP A 19 ? ? 57.09 70.29 18 5 GLU A 23 ? ? -98.11 -68.81 19 5 ASP A 30 ? ? 62.48 -99.86 20 5 TYR A 37 ? ? -160.41 105.74 21 5 ALA A 75 ? ? -49.97 108.00 22 6 ASP A 26 ? ? -146.83 -23.97 23 6 ALA A 43 ? ? -170.06 115.75 24 6 LEU A 77 ? ? -78.26 -74.88 25 6 THR A 100 ? ? -112.06 -163.87 26 6 PRO A 104 ? ? -56.86 101.26 27 7 PRO A 76 ? ? -94.44 -159.35 28 7 LEU A 77 ? ? -89.87 -84.18 29 7 PRO A 106 ? ? -75.54 21.88 30 8 PRO A 41 ? ? -69.51 88.29 31 8 LEU A 77 ? ? 176.25 179.36 32 8 SER A 78 ? ? -63.70 96.92 33 8 ASN A 99 ? ? -102.85 -165.45 34 8 PRO A 104 ? ? -75.24 36.16 35 9 GLU A 27 ? ? -153.18 80.50 36 9 ALA A 38 ? ? -163.49 92.26 37 9 PRO A 41 ? ? -83.33 48.86 38 9 ASP A 47 ? ? -130.19 -71.57 39 9 SER A 58 ? ? 70.79 119.33 40 9 ALA A 75 ? ? -48.69 107.00 41 9 SER A 101 ? ? 59.10 19.96 42 10 ALA A 3 ? ? -111.72 71.14 43 10 LEU A 55 ? ? 60.50 90.87 44 10 ALA A 75 ? ? -53.42 108.01 45 10 LEU A 77 ? ? 70.45 -79.57 46 10 PRO A 106 ? ? -64.80 96.28 47 11 TYR A 22 ? ? -114.93 72.49 48 11 GLU A 23 ? ? 56.91 -142.53 49 11 ASP A 34 ? ? -92.39 55.62 50 11 ALA A 38 ? ? 70.14 -70.29 51 11 ALA A 75 ? ? -47.13 109.63 52 12 THR A 10 ? ? 62.38 72.71 53 12 ASP A 13 ? ? -86.24 -102.79 54 12 ASP A 34 ? ? -92.55 -76.37 55 12 SER A 35 ? ? 67.74 115.27 56 12 MET A 49 ? ? 57.57 88.17 57 12 SER A 101 ? ? 64.47 -72.16 58 13 ASN A 9 ? ? 69.74 100.92 59 13 ILE A 32 ? ? 73.09 -1.77 60 13 ASP A 47 ? ? 65.44 92.72 61 13 PHE A 74 ? ? -82.52 -140.85 62 13 LEU A 77 ? ? -88.05 -85.55 63 13 SER A 101 ? ? 73.33 -58.08 64 13 LEU A 107 ? ? -96.76 38.30 65 14 LYS A 7 ? ? 74.59 118.85 66 14 ASN A 40 ? ? 73.95 125.24 67 14 LEU A 77 ? ? 168.78 -168.00 68 14 SER A 101 ? ? 70.99 -74.72 69 14 PRO A 106 ? ? -61.37 98.93 70 14 ASN A 124 ? ? -125.90 -168.22 71 14 HIS A 144 ? ? -135.90 -78.04 72 15 ASN A 2 ? ? -111.54 75.90 73 15 ALA A 75 ? ? -44.94 106.50 74 15 LEU A 77 ? ? -83.39 -151.08 75 15 PRO A 104 ? ? -56.38 101.81 76 16 SER A 45 ? ? -95.19 51.14 77 16 LEU A 77 ? ? 175.41 172.18 78 16 PRO A 104 ? ? -36.03 99.33 79 16 ASN A 126 ? ? -90.77 -61.12 80 17 ASN A 2 ? ? 67.60 89.96 81 17 ASN A 9 ? ? -162.26 110.18 82 17 GLU A 42 ? ? -110.72 -165.24 83 17 SER A 45 ? ? -98.54 -86.25 84 17 PRO A 104 ? ? -75.98 27.83 85 18 ASN A 6 ? ? -162.04 102.32 86 18 ALA A 43 ? ? -99.13 38.52 87 18 SER A 58 ? ? 58.78 84.13 88 18 LEU A 77 ? ? -85.85 -79.79 89 18 PRO A 106 ? ? -68.88 82.40 90 18 HIS A 142 ? ? 71.96 -27.32 91 19 SER A 20 ? ? -152.24 39.81 92 19 TYR A 22 ? ? 74.24 103.37 93 19 MET A 52 ? ? 74.21 -37.61 94 19 LEU A 77 ? ? 178.55 -175.02 95 19 SER A 101 ? ? 61.50 -42.75 96 20 ASN A 6 ? ? -86.14 -71.57 97 20 SER A 25 ? ? -150.83 85.66 98 20 SER A 78 ? ? -171.85 147.54 99 20 PRO A 104 ? ? -53.85 108.67 #