data_2L01 # _entry.id 2L01 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L01 pdb_00002l01 10.2210/pdb2l01/pdb RCSB RCSB101785 ? ? WWPDB D_1000101785 ? ? BMRB 17025 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified BvR153 TargetDB . unspecified 17025 BMRB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L01 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-06-29 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Eletsky, A.' 1 'Lee, C.' 2 'Wang, K.' 3 'Ciccosanti, T.B.' 4 'Hamilton, R.' 5 'Acton, J.B.' 6 'Xiao, G.B.' 7 'Everett, J.K.' 8 'Prestegard, J.H.' 9 'Montelione, G.T.' 10 'Szyperski, T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Solution NMR Structure of protein BVU3908 from Bacteroides vulgatus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eletsky, A.' 1 ? primary 'Lee, D.' 2 ? primary 'Wang, C.' 3 ? primary 'Ciccosanti, K.' 4 ? primary 'Hamilton, T.B.' 5 ? primary 'Acton, R.B.' 6 ? primary 'Xiao, J.B.' 7 ? primary 'Everett, G.K.' 8 ? primary 'Prestegard, T.H.' 9 ? primary 'Montelione, G.T.' 10 ? primary 'Szyperski, T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 8775.248 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKMLKEKAGALAGQIWEALNGTEGLTQKQIKKATKLKADKDFFLGLGWLLREDKVVTSEVEGEIFVKLVLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MKMLKEKAGALAGQIWEALNGTEGLTQKQIKKATKLKADKDFFLGLGWLLREDKVVTSEVEGEIFVKLVLEHHHHHH _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier BvR153 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 MET n 1 4 LEU n 1 5 LYS n 1 6 GLU n 1 7 LYS n 1 8 ALA n 1 9 GLY n 1 10 ALA n 1 11 LEU n 1 12 ALA n 1 13 GLY n 1 14 GLN n 1 15 ILE n 1 16 TRP n 1 17 GLU n 1 18 ALA n 1 19 LEU n 1 20 ASN n 1 21 GLY n 1 22 THR n 1 23 GLU n 1 24 GLY n 1 25 LEU n 1 26 THR n 1 27 GLN n 1 28 LYS n 1 29 GLN n 1 30 ILE n 1 31 LYS n 1 32 LYS n 1 33 ALA n 1 34 THR n 1 35 LYS n 1 36 LEU n 1 37 LYS n 1 38 ALA n 1 39 ASP n 1 40 LYS n 1 41 ASP n 1 42 PHE n 1 43 PHE n 1 44 LEU n 1 45 GLY n 1 46 LEU n 1 47 GLY n 1 48 TRP n 1 49 LEU n 1 50 LEU n 1 51 ARG n 1 52 GLU n 1 53 ASP n 1 54 LYS n 1 55 VAL n 1 56 VAL n 1 57 THR n 1 58 SER n 1 59 GLU n 1 60 VAL n 1 61 GLU n 1 62 GLY n 1 63 GLU n 1 64 ILE n 1 65 PHE n 1 66 VAL n 1 67 LYS n 1 68 LEU n 1 69 VAL n 1 70 LEU n 1 71 GLU n 1 72 HIS n 1 73 HIS n 1 74 HIS n 1 75 HIS n 1 76 HIS n 1 77 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BVU_3908 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 8482' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides vulgatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 435590 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)pMgK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET 21-23C' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A6L747_BACV8 _struct_ref.pdbx_db_accession A6L747 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKMLKEKAGALAGQIWEALNGTEGLTQKQIKKATKLKADKDFFLGLGWLLREDKVVTSEVEGEIFVKLV _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2L01 A 1 ? 69 ? A6L747 1 ? 69 ? 1 69 2 1 2L01 B 1 ? 69 ? A6L747 1 ? 69 ? 1 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L01 LEU A 70 ? UNP A6L747 ? ? 'expression tag' 70 1 1 2L01 GLU A 71 ? UNP A6L747 ? ? 'expression tag' 71 2 1 2L01 HIS A 72 ? UNP A6L747 ? ? 'expression tag' 72 3 1 2L01 HIS A 73 ? UNP A6L747 ? ? 'expression tag' 73 4 1 2L01 HIS A 74 ? UNP A6L747 ? ? 'expression tag' 74 5 1 2L01 HIS A 75 ? UNP A6L747 ? ? 'expression tag' 75 6 1 2L01 HIS A 76 ? UNP A6L747 ? ? 'expression tag' 76 7 1 2L01 HIS A 77 ? UNP A6L747 ? ? 'expression tag' 77 8 2 2L01 LEU B 70 ? UNP A6L747 ? ? 'expression tag' 70 9 2 2L01 GLU B 71 ? UNP A6L747 ? ? 'expression tag' 71 10 2 2L01 HIS B 72 ? UNP A6L747 ? ? 'expression tag' 72 11 2 2L01 HIS B 73 ? UNP A6L747 ? ? 'expression tag' 73 12 2 2L01 HIS B 74 ? UNP A6L747 ? ? 'expression tag' 74 13 2 2L01 HIS B 75 ? UNP A6L747 ? ? 'expression tag' 75 14 2 2L01 HIS B 76 ? UNP A6L747 ? ? 'expression tag' 76 15 2 2L01 HIS B 77 ? UNP A6L747 ? ? 'expression tag' 77 16 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C CT-HSQC aliphatic' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '2D 1H-13C CT-HSQC aromatic' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 1 '3D HN(CA)CO' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D HCCH-COSY aliphatic' 1 11 1 '3D HCCH-COSY aromatic' 1 12 1 '3D HCCH-TOCSY aliphatic' 1 13 2 '2D 1H-13C CT-HSQC methyl' 1 14 2 '2D J-modulation 1H-15N HSQC' 1 15 3 '2D J-modulation 1H-15N HSQC' 1 16 4 '2D J-modulation 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1.2 mM [U-100% 13C; U-100% 15N] BvR153, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 0.02 % sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1.1 mM [U-5% 13C; U-100% 15N] BvR153, 20 mM MES, 100 mM sodium chloride, 5 mM calcium chloride, 0.02 % sodium azide, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' ;0.7 mM [U-5% 13C; U-100% 15N] BvR153, 13 mM MES, 67 mM sodium chloride, 3.4 mM calcium chloride, 0.013 % sodium azide, 4.0 % C12E5 polyethylene glycol, 4 % hexanol, 80% H2O/20% D2O ; 3 '80% H2O/20% D2O' ;1.0 mM [U-5% 13C; U-100% 15N] BvR153, 18 mM MES, 92 mM sodium chloride, 34.6 mM calcium chloride, 0.018 % sodium azide, 80% H2O/20% D2O ; 4 '80% H2O/20% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L01 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Structure determination was performed iteratively with CYANA 3.0 using NOE-based constraints, PHI and PSI dihedral angle constraints from TALOS+, and backbone H-N RDC constraints from two alignment media. The 20 conformers out of 100 with the lowest target function were further refined by simulated annealing in explicit water bath using the program CNS with PARAM19 force field and upper limit constraints relaxed by 5% ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L01 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L01 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.2 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS 1.2 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.2.1 7 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.3.0 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.3.0 9 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 10 'Bartels et al.' 'data analysis' XEASY 1.3.13 11 Varian collection VnmrJ 2.1B 12 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ 1.2009.0721.18 13 'Keller and Wuthrich' 'chemical shift assignment' CARA 1.8.4 14 'Keller and Wuthrich' 'data analysis' CARA 1.8.4 15 'Keller and Wuthrich' 'peak picking' CARA 1.8.4 16 Guntert processing PROSA 6.4 17 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L01 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L01 _struct.title 'Solution NMR Structure of protein BVU3908 from Bacteroides vulgatus, Northeast Structural Genomics Consortium Target BvR153' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L01 _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown function' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, Unknown function' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 3 ? ASN A 20 ? MET A 3 ASN A 20 1 ? 18 HELX_P HELX_P2 2 GLN A 27 ? LYS A 35 ? GLN A 27 LYS A 35 1 ? 9 HELX_P HELX_P3 3 ALA A 38 ? GLU A 52 ? ALA A 38 GLU A 52 1 ? 15 HELX_P HELX_P4 4 MET B 3 ? ASN B 20 ? MET B 3 ASN B 20 1 ? 18 HELX_P HELX_P5 5 GLN B 27 ? LYS B 35 ? GLN B 27 LYS B 35 1 ? 9 HELX_P HELX_P6 6 ASP B 39 ? GLU B 52 ? ASP B 39 GLU B 52 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 25 ? THR A 26 ? LEU A 25 THR A 26 A 2 GLU A 63 ? LEU A 68 ? GLU A 63 LEU A 68 A 3 VAL A 55 ? VAL A 60 ? VAL A 55 VAL A 60 B 1 LEU B 25 ? THR B 26 ? LEU B 25 THR B 26 B 2 GLU B 63 ? LEU B 68 ? GLU B 63 LEU B 68 B 3 VAL B 55 ? VAL B 60 ? VAL B 55 VAL B 60 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 25 ? N LEU A 25 O VAL A 66 ? O VAL A 66 A 2 3 O PHE A 65 ? O PHE A 65 N SER A 58 ? N SER A 58 B 1 2 N LEU B 25 ? N LEU B 25 O VAL B 66 ? O VAL B 66 B 2 3 O PHE B 65 ? O PHE B 65 N SER B 58 ? N SER B 58 # _atom_sites.entry_id 2L01 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 TRP 16 16 16 TRP TRP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 HIS 76 76 76 HIS HIS A . n A 1 77 HIS 77 77 77 HIS HIS A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 LYS 2 2 2 LYS LYS B . n B 1 3 MET 3 3 3 MET MET B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 LYS 5 5 5 LYS LYS B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 ALA 8 8 8 ALA ALA B . n B 1 9 GLY 9 9 9 GLY GLY B . n B 1 10 ALA 10 10 10 ALA ALA B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 GLY 13 13 13 GLY GLY B . n B 1 14 GLN 14 14 14 GLN GLN B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 TRP 16 16 16 TRP TRP B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 ALA 18 18 18 ALA ALA B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 ASN 20 20 20 ASN ASN B . n B 1 21 GLY 21 21 21 GLY GLY B . n B 1 22 THR 22 22 22 THR THR B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 GLY 24 24 24 GLY GLY B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 GLN 27 27 27 GLN GLN B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 GLN 29 29 29 GLN GLN B . n B 1 30 ILE 30 30 30 ILE ILE B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 ALA 33 33 33 ALA ALA B . n B 1 34 THR 34 34 34 THR THR B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 LYS 37 37 37 LYS LYS B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 ASP 39 39 39 ASP ASP B . n B 1 40 LYS 40 40 40 LYS LYS B . n B 1 41 ASP 41 41 41 ASP ASP B . n B 1 42 PHE 42 42 42 PHE PHE B . n B 1 43 PHE 43 43 43 PHE PHE B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 GLY 45 45 45 GLY GLY B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 GLY 47 47 47 GLY GLY B . n B 1 48 TRP 48 48 48 TRP TRP B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 LEU 50 50 50 LEU LEU B . n B 1 51 ARG 51 51 51 ARG ARG B . n B 1 52 GLU 52 52 52 GLU GLU B . n B 1 53 ASP 53 53 53 ASP ASP B . n B 1 54 LYS 54 54 54 LYS LYS B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 THR 57 57 57 THR THR B . n B 1 58 SER 58 58 58 SER SER B . n B 1 59 GLU 59 59 59 GLU GLU B . n B 1 60 VAL 60 60 60 VAL VAL B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 GLY 62 62 62 GLY GLY B . n B 1 63 GLU 63 63 63 GLU GLU B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 PHE 65 65 65 PHE PHE B . n B 1 66 VAL 66 66 66 VAL VAL B . n B 1 67 LYS 67 67 67 LYS LYS B . n B 1 68 LEU 68 68 68 LEU LEU B . n B 1 69 VAL 69 69 69 VAL VAL B . n B 1 70 LEU 70 70 70 LEU LEU B . n B 1 71 GLU 71 71 71 GLU GLU B . n B 1 72 HIS 72 72 72 HIS HIS B . n B 1 73 HIS 73 73 73 HIS HIS B . n B 1 74 HIS 74 74 74 HIS HIS B . n B 1 75 HIS 75 75 75 HIS HIS B . n B 1 76 HIS 76 76 76 HIS HIS B . n B 1 77 HIS 77 77 77 HIS HIS B . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-08-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id BvR153-1 1.2 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'calcium chloride-4' 5 ? mM ? 1 'sodium azide-5' 0.02 ? % ? 1 BvR153-6 1.1 ? mM '[U-5% 13C; U-100% 15N]' 2 MES-7 20 ? mM ? 2 'sodium chloride-8' 100 ? mM ? 2 'calcium chloride-9' 5 ? mM ? 2 'sodium azide-10' 0.02 ? % ? 2 BvR153-11 0.7 ? mM '[U-5% 13C; U-100% 15N]' 3 MES-12 13 ? mM ? 3 'sodium chloride-13' 67 ? mM ? 3 'calcium chloride-14' 3.4 ? mM ? 3 'sodium azide-15' 0.013 ? % ? 3 PEG-16 4.0 ? % ? 3 BvR153-17 1.0 ? mM '[U-5% 13C; U-100% 15N]' 4 MES-18 18 ? mM ? 4 'sodium chloride-19' 92 ? mM ? 4 'calcium chloride-20' 34.6 ? mM ? 4 'sodium azide-21' 0.018 ? % ? 4 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L01 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2554 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 541 _pdbx_nmr_constraints.NOE_long_range_total_count 665 _pdbx_nmr_constraints.NOE_medium_range_total_count 726 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 622 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 112 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 112 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 69 ? ? -68.82 98.99 2 1 HIS A 75 ? ? -69.50 81.96 3 1 HIS B 76 ? ? 64.11 -161.16 4 2 LYS A 2 ? ? -61.33 95.15 5 3 HIS A 73 ? ? -105.20 62.53 6 4 VAL A 69 ? ? -83.89 36.91 7 4 VAL B 69 ? ? -67.03 87.34 8 5 LEU A 70 ? ? -91.85 34.39 9 5 LYS B 2 ? ? -62.95 91.42 10 5 VAL B 69 ? ? -69.25 96.35 11 6 HIS A 73 ? ? -160.25 97.05 12 6 LYS B 2 ? ? 58.04 78.65 13 6 VAL B 69 ? ? 57.55 16.82 14 6 HIS B 74 ? ? -163.07 93.74 15 6 HIS B 76 ? ? -170.50 125.56 16 7 VAL A 69 ? ? -69.07 94.39 17 7 HIS B 72 ? ? -71.37 -76.98 18 7 HIS B 73 ? ? 38.14 117.10 19 7 HIS B 75 ? ? 71.14 113.84 20 8 GLU A 71 ? ? -65.49 89.88 21 8 HIS A 74 ? ? -58.38 98.66 22 8 LEU B 70 ? ? -66.99 86.70 23 9 HIS A 72 ? ? -100.34 58.52 24 9 HIS A 73 ? ? -133.56 -38.32 25 9 HIS A 74 ? ? -89.37 32.48 26 9 VAL B 69 ? ? 49.63 27.79 27 9 GLU B 71 ? ? 62.48 86.47 28 10 LYS A 2 ? ? -162.69 -24.25 29 10 LYS A 37 ? ? 70.51 -64.07 30 10 LEU A 70 ? ? -64.88 95.08 31 10 HIS A 76 ? ? 65.22 91.22 32 10 GLU B 23 ? ? -79.52 23.09 33 10 GLU B 71 ? ? 65.84 104.84 34 10 HIS B 72 ? ? -154.87 14.31 35 10 HIS B 74 ? ? -52.03 94.30 36 11 LEU B 70 ? ? -58.31 108.15 37 11 HIS B 72 ? ? -59.17 91.11 38 12 LYS A 2 ? ? 63.22 84.78 39 12 LEU A 70 ? ? -52.35 98.67 40 12 HIS A 73 ? ? 62.01 85.38 41 12 GLU B 23 ? ? -86.28 34.36 42 13 VAL A 69 ? ? -67.97 87.36 43 13 HIS A 75 ? ? -69.19 90.94 44 13 LYS B 35 ? ? 72.10 37.53 45 14 HIS B 72 ? ? -93.11 45.33 46 15 VAL B 69 ? ? 28.84 62.09 47 16 LEU A 70 ? ? -69.70 90.18 48 16 HIS A 76 ? ? -123.44 -156.57 49 16 LYS B 35 ? ? 72.89 39.33 50 16 LYS B 37 ? ? -148.92 -28.02 51 16 HIS B 74 ? ? -63.71 96.15 52 17 LEU A 70 ? ? -57.81 99.13 53 17 LEU B 68 ? ? -86.24 44.47 54 18 GLU A 71 ? ? -64.32 93.53 55 18 LYS B 2 ? ? -91.08 32.34 56 18 HIS B 75 ? ? 70.64 -64.88 57 19 HIS A 73 ? ? 53.41 78.41 58 19 HIS B 76 ? ? -62.38 97.08 59 20 LEU A 70 ? ? 78.69 -29.19 60 20 HIS A 74 ? ? -131.82 -90.65 61 20 HIS A 75 ? ? -171.58 141.84 62 20 LEU B 70 ? ? -93.76 42.94 63 20 GLU B 71 ? ? 62.81 -66.62 64 20 HIS B 75 ? ? -69.91 -74.95 #