data_2L17 # _entry.id 2L17 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L17 RCSB RCSB101827 WWPDB D_1000101827 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2L18 unspecified . PDB 2L19 unspecified . BMRB 17076 unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L17 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-07-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yu, C.' 1 'Xia, B.' 2 'Jin, C.' 3 # _citation.id primary _citation.title '(1)H, (13)C and (15)N resonance assignments of the arsenate reductase from Synechocystis sp. strain PCC 6803' _citation.journal_abbrev 'Biomol.Nmr Assign.' _citation.journal_volume 5 _citation.page_first 85 _citation.page_last 87 _citation.year 2011 _citation.journal_id_ASTM ? _citation.country NE _citation.journal_id_ISSN 1874-2718 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20960080 _citation.pdbx_database_id_DOI 10.1007/s12104-010-9273-2 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yu, C.' 1 primary 'Xia, B.' 2 primary 'Jin, C.' 3 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Arsenate reductase' _entity.formula_weight 14739.713 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 1.20.4.1 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name SynArsC # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVI SLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVI SLCGCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 LYS n 1 6 LYS n 1 7 VAL n 1 8 MET n 1 9 PHE n 1 10 VAL n 1 11 CYS n 1 12 LYS n 1 13 ARG n 1 14 ASN n 1 15 SER n 1 16 CYS n 1 17 ARG n 1 18 SER n 1 19 GLN n 1 20 MET n 1 21 ALA n 1 22 GLU n 1 23 GLY n 1 24 PHE n 1 25 ALA n 1 26 LYS n 1 27 THR n 1 28 LEU n 1 29 GLY n 1 30 ALA n 1 31 GLY n 1 32 LYS n 1 33 ILE n 1 34 ALA n 1 35 VAL n 1 36 THR n 1 37 SER n 1 38 CYS n 1 39 GLY n 1 40 LEU n 1 41 GLU n 1 42 SER n 1 43 SER n 1 44 ARG n 1 45 VAL n 1 46 HIS n 1 47 PRO n 1 48 THR n 1 49 ALA n 1 50 ILE n 1 51 ALA n 1 52 MET n 1 53 MET n 1 54 GLU n 1 55 GLU n 1 56 VAL n 1 57 GLY n 1 58 ILE n 1 59 ASP n 1 60 ILE n 1 61 SER n 1 62 GLY n 1 63 GLN n 1 64 THR n 1 65 SER n 1 66 ASP n 1 67 PRO n 1 68 ILE n 1 69 GLU n 1 70 ASN n 1 71 PHE n 1 72 ASN n 1 73 ALA n 1 74 ASP n 1 75 ASP n 1 76 TYR n 1 77 ASP n 1 78 VAL n 1 79 VAL n 1 80 ILE n 1 81 SER n 1 82 LEU n 1 83 CYS n 1 84 GLY n 1 85 CYS n 1 86 GLY n 1 87 VAL n 1 88 ASN n 1 89 LEU n 1 90 PRO n 1 91 PRO n 1 92 GLU n 1 93 TRP n 1 94 VAL n 1 95 THR n 1 96 GLN n 1 97 GLU n 1 98 ILE n 1 99 PHE n 1 100 GLU n 1 101 ASP n 1 102 TRP n 1 103 GLN n 1 104 LEU n 1 105 GLU n 1 106 ASP n 1 107 PRO n 1 108 ASP n 1 109 GLY n 1 110 GLN n 1 111 SER n 1 112 LEU n 1 113 GLU n 1 114 VAL n 1 115 PHE n 1 116 ARG n 1 117 THR n 1 118 VAL n 1 119 ARG n 1 120 GLY n 1 121 GLN n 1 122 VAL n 1 123 LYS n 1 124 GLU n 1 125 ARG n 1 126 VAL n 1 127 GLU n 1 128 ASN n 1 129 LEU n 1 130 ILE n 1 131 ALA n 1 132 LYS n 1 133 ILE n 1 134 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'arsC, slr0946' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'PCC 6803' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name Synechocystis _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1148 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET28a(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P74313_SYNY3 _struct_ref.pdbx_db_accession P74313 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKKVMFVCKRNSCRSQMAEGFAKTLGAGKIAVTSCGLESSRVHPTAIAMMEEVGIDISGQTSDPIENFNADDYDVVISLC GCGVNLPPEWVTQEIFEDWQLEDPDGQSLEVFRTVRGQVKERVENLIAKIS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L17 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P74313 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 131 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L17 GLY A 1 ? UNP P74313 ? ? 'EXPRESSION TAG' -2 1 1 2L17 SER A 2 ? UNP P74313 ? ? 'EXPRESSION TAG' -1 2 1 2L17 HIS A 3 ? UNP P74313 ? ? 'EXPRESSION TAG' 0 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '3D CBCA(CO)NH' 1 3 2 '3D C(CO)NH' 1 4 2 '3D HNCO' 1 5 2 '3D HNCA' 1 6 2 '3D HNCACB' 1 7 2 '3D HBHA(CO)NH' 1 8 2 '3D H(CCO)NH' 1 9 2 '3D HN(CO)CA' 1 10 2 '3D HCCH-TOCSY' 1 11 1 '3D 1H-15N NOESY' 1 12 2 '3D CCH-TOCSY' 1 13 2 '3D CCH-COSY' 1 14 2 '3D HCCH-COSY' 1 15 2 '3D 1H-13C NOESY' 1 16 2 '3D 1H-13C AROMATIC CNOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-15N] SynArsC-1, 0.01 % DSS-2, 0.01 % sodium azide-3, 50 mM sodium chloride-4, 50 mM TRIS-5, 40 mM DTT-6, 10 % D2O-7, 90 % H2O-8, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-13C; U-15N] SynArsC-9, 0.01 % DSS-10, 0.01 % sodium azide-11, 50 mM sodium chloride-12, 50 mM TRIS-13, 40 mM DTT-14, 10 % D2O-15, 90 % H2O-16, 90% H2O/10% D2O ; 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker Avance 1 'Bruker Avance' 800 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L17 _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L17 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L17 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 'Duggan, Legge, Dyson & Wright' 'chemical shift assignment' SANE ? 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 4 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement AMBER ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L17 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L17 _struct.title 'An arsenate reductase in the reduced state' _struct.pdbx_descriptor 'Arsenate reductase (E.C.1.20.4.1)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L17 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'alpha/beta sandwich, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? GLY A 29 ? SER A 12 GLY A 26 1 ? 15 HELX_P HELX_P2 2 HIS A 46 ? GLU A 55 ? HIS A 43 GLU A 52 1 ? 10 HELX_P HELX_P3 3 PRO A 67 ? PHE A 71 ? PRO A 64 PHE A 68 5 ? 5 HELX_P HELX_P4 4 ASN A 72 ? TYR A 76 ? ASN A 69 TYR A 73 5 ? 5 HELX_P HELX_P5 5 PRO A 91 ? GLN A 96 ? PRO A 88 GLN A 93 1 ? 6 HELX_P HELX_P6 6 SER A 111 ? SER A 134 ? SER A 108 SER A 131 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 33 ? CYS A 38 ? ILE A 30 CYS A 35 A 2 LYS A 5 ? VAL A 10 ? LYS A 2 VAL A 7 A 3 VAL A 78 ? SER A 81 ? VAL A 75 SER A 78 A 4 ILE A 98 ? ASP A 101 ? ILE A 95 ASP A 98 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ALA A 34 ? O ALA A 31 N LYS A 5 ? N LYS A 2 A 2 3 N VAL A 10 ? N VAL A 7 O ILE A 80 ? O ILE A 77 A 3 4 N SER A 81 ? N SER A 78 O GLU A 100 ? O GLU A 97 # _atom_sites.entry_id 2L17 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 LYS 5 2 2 LYS LYS A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 VAL 7 4 4 VAL VAL A . n A 1 8 MET 8 5 5 MET MET A . n A 1 9 PHE 9 6 6 PHE PHE A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 CYS 11 8 8 CYS CYS A . n A 1 12 LYS 12 9 9 LYS LYS A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 ASN 14 11 11 ASN ASN A . n A 1 15 SER 15 12 12 SER SER A . n A 1 16 CYS 16 13 13 CYS CYS A . n A 1 17 ARG 17 14 14 ARG ARG A . n A 1 18 SER 18 15 15 SER SER A . n A 1 19 GLN 19 16 16 GLN GLN A . n A 1 20 MET 20 17 17 MET MET A . n A 1 21 ALA 21 18 18 ALA ALA A . n A 1 22 GLU 22 19 19 GLU GLU A . n A 1 23 GLY 23 20 20 GLY GLY A . n A 1 24 PHE 24 21 21 PHE PHE A . n A 1 25 ALA 25 22 22 ALA ALA A . n A 1 26 LYS 26 23 23 LYS LYS A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 GLY 29 26 26 GLY GLY A . n A 1 30 ALA 30 27 27 ALA ALA A . n A 1 31 GLY 31 28 28 GLY GLY A . n A 1 32 LYS 32 29 29 LYS LYS A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 ALA 34 31 31 ALA ALA A . n A 1 35 VAL 35 32 32 VAL VAL A . n A 1 36 THR 36 33 33 THR THR A . n A 1 37 SER 37 34 34 SER SER A . n A 1 38 CYS 38 35 35 CYS CYS A . n A 1 39 GLY 39 36 36 GLY GLY A . n A 1 40 LEU 40 37 37 LEU LEU A . n A 1 41 GLU 41 38 38 GLU GLU A . n A 1 42 SER 42 39 39 SER SER A . n A 1 43 SER 43 40 40 SER SER A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 VAL 45 42 42 VAL VAL A . n A 1 46 HIS 46 43 43 HIS HIS A . n A 1 47 PRO 47 44 44 PRO PRO A . n A 1 48 THR 48 45 45 THR THR A . n A 1 49 ALA 49 46 46 ALA ALA A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 ALA 51 48 48 ALA ALA A . n A 1 52 MET 52 49 49 MET MET A . n A 1 53 MET 53 50 50 MET MET A . n A 1 54 GLU 54 51 51 GLU GLU A . n A 1 55 GLU 55 52 52 GLU GLU A . n A 1 56 VAL 56 53 53 VAL VAL A . n A 1 57 GLY 57 54 54 GLY GLY A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 ASP 59 56 56 ASP ASP A . n A 1 60 ILE 60 57 57 ILE ILE A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 GLY 62 59 59 GLY GLY A . n A 1 63 GLN 63 60 60 GLN GLN A . n A 1 64 THR 64 61 61 THR THR A . n A 1 65 SER 65 62 62 SER SER A . n A 1 66 ASP 66 63 63 ASP ASP A . n A 1 67 PRO 67 64 64 PRO PRO A . n A 1 68 ILE 68 65 65 ILE ILE A . n A 1 69 GLU 69 66 66 GLU GLU A . n A 1 70 ASN 70 67 67 ASN ASN A . n A 1 71 PHE 71 68 68 PHE PHE A . n A 1 72 ASN 72 69 69 ASN ASN A . n A 1 73 ALA 73 70 70 ALA ALA A . n A 1 74 ASP 74 71 71 ASP ASP A . n A 1 75 ASP 75 72 72 ASP ASP A . n A 1 76 TYR 76 73 73 TYR TYR A . n A 1 77 ASP 77 74 74 ASP ASP A . n A 1 78 VAL 78 75 75 VAL VAL A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 ILE 80 77 77 ILE ILE A . n A 1 81 SER 81 78 78 SER SER A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 CYS 83 80 80 CYS CYS A . n A 1 84 GLY 84 81 81 GLY GLY A . n A 1 85 CYS 85 82 82 CYS CYS A . n A 1 86 GLY 86 83 83 GLY GLY A . n A 1 87 VAL 87 84 84 VAL VAL A . n A 1 88 ASN 88 85 85 ASN ASN A . n A 1 89 LEU 89 86 86 LEU LEU A . n A 1 90 PRO 90 87 87 PRO PRO A . n A 1 91 PRO 91 88 88 PRO PRO A . n A 1 92 GLU 92 89 89 GLU GLU A . n A 1 93 TRP 93 90 90 TRP TRP A . n A 1 94 VAL 94 91 91 VAL VAL A . n A 1 95 THR 95 92 92 THR THR A . n A 1 96 GLN 96 93 93 GLN GLN A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 ILE 98 95 95 ILE ILE A . n A 1 99 PHE 99 96 96 PHE PHE A . n A 1 100 GLU 100 97 97 GLU GLU A . n A 1 101 ASP 101 98 98 ASP ASP A . n A 1 102 TRP 102 99 99 TRP TRP A . n A 1 103 GLN 103 100 100 GLN GLN A . n A 1 104 LEU 104 101 101 LEU LEU A . n A 1 105 GLU 105 102 102 GLU GLU A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 PRO 107 104 104 PRO PRO A . n A 1 108 ASP 108 105 105 ASP ASP A . n A 1 109 GLY 109 106 106 GLY GLY A . n A 1 110 GLN 110 107 107 GLN GLN A . n A 1 111 SER 111 108 108 SER SER A . n A 1 112 LEU 112 109 109 LEU LEU A . n A 1 113 GLU 113 110 110 GLU GLU A . n A 1 114 VAL 114 111 111 VAL VAL A . n A 1 115 PHE 115 112 112 PHE PHE A . n A 1 116 ARG 116 113 113 ARG ARG A . n A 1 117 THR 117 114 114 THR THR A . n A 1 118 VAL 118 115 115 VAL VAL A . n A 1 119 ARG 119 116 116 ARG ARG A . n A 1 120 GLY 120 117 117 GLY GLY A . n A 1 121 GLN 121 118 118 GLN GLN A . n A 1 122 VAL 122 119 119 VAL VAL A . n A 1 123 LYS 123 120 120 LYS LYS A . n A 1 124 GLU 124 121 121 GLU GLU A . n A 1 125 ARG 125 122 122 ARG ARG A . n A 1 126 VAL 126 123 123 VAL VAL A . n A 1 127 GLU 127 124 124 GLU GLU A . n A 1 128 ASN 128 125 125 ASN ASN A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 ILE 130 127 127 ILE ILE A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 LYS 132 129 129 LYS LYS A . n A 1 133 ILE 133 130 130 ILE ILE A . n A 1 134 SER 134 131 131 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-04-13 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SynArsC-1 1 ? mM '[U-15N]' 1 DSS-2 0.01 ? % ? 1 'sodium azide-3' 0.01 ? % ? 1 'sodium chloride-4' 50 ? mM ? 1 TRIS-5 50 ? mM ? 1 DTT-6 40 ? mM ? 1 D2O-7 10 ? % ? 1 H2O-8 90 ? % ? 1 SynArsC-9 1 ? mM '[U-13C; U-15N]' 2 DSS-10 0.01 ? % ? 2 'sodium azide-11' 0.01 ? % ? 2 'sodium chloride-12' 50 ? mM ? 2 TRIS-13 50 ? mM ? 2 DTT-14 40 ? mM ? 2 D2O-15 10 ? % ? 2 H2O-16 90 ? % ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HG A SER 78 ? ? OD2 A ASP 98 ? ? 1.59 2 4 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.59 3 5 HG A SER 78 ? ? OD2 A ASP 98 ? ? 1.60 4 6 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.54 5 7 OD1 A ASP 56 ? ? HG A SER 58 ? ? 1.58 6 7 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.58 7 8 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.54 8 9 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.58 9 10 OD1 A ASP 56 ? ? HG A SER 58 ? ? 1.59 10 11 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.57 11 12 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.54 12 14 OD1 A ASP 56 ? ? HG A SER 58 ? ? 1.60 13 15 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.57 14 15 OD1 A ASP 56 ? ? HG A SER 58 ? ? 1.59 15 17 OE1 A GLU 19 ? ? HG A SER 34 ? ? 1.55 16 17 HG A SER 78 ? ? OD2 A ASP 98 ? ? 1.58 17 20 OD1 A ASP 56 ? ? HG A SER 58 ? ? 1.54 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 110.73 100.20 10.53 1.60 N 2 2 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 111.90 100.20 11.70 1.60 N 3 4 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 109.83 100.20 9.63 1.60 N 4 5 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 111.42 100.20 11.22 1.60 N 5 7 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 110.85 100.20 10.65 1.60 N 6 8 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 111.46 100.20 11.26 1.60 N 7 10 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 110.29 100.20 10.09 1.60 N 8 11 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 111.11 100.20 10.91 1.60 N 9 12 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 111.17 100.20 10.97 1.60 N 10 13 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 111.54 100.20 11.34 1.60 N 11 14 NE A ARG 10 ? ? CZ A ARG 10 ? ? NH2 A ARG 10 ? ? 117.23 120.30 -3.07 0.50 N 12 14 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 112.13 100.20 11.93 1.60 N 13 16 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 113.53 100.20 13.33 1.60 N 14 17 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 112.56 100.20 12.36 1.60 N 15 18 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 110.96 100.20 10.76 1.60 N 16 20 CG A MET 17 ? ? SD A MET 17 ? ? CE A MET 17 ? ? 110.10 100.20 9.90 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 10 ? ? 54.75 -146.10 2 1 ASN A 11 ? ? -65.55 99.37 3 1 LEU A 37 ? ? -163.04 61.29 4 1 SER A 40 ? ? 59.68 -13.22 5 1 LEU A 79 ? ? -142.69 38.04 6 1 GLN A 100 ? ? -54.54 41.79 7 1 ASP A 105 ? ? 20.06 -91.85 8 2 ARG A 10 ? ? 63.47 176.53 9 2 CYS A 13 ? ? -59.44 -5.34 10 2 SER A 40 ? ? 62.08 -29.33 11 2 LEU A 79 ? ? -140.76 32.18 12 2 CYS A 82 ? ? 35.88 45.03 13 2 ASN A 85 ? ? -118.09 56.35 14 2 GLN A 100 ? ? -62.60 33.99 15 2 ASP A 105 ? ? 26.42 -99.04 16 3 LYS A 9 ? ? -144.32 -125.17 17 3 ASN A 11 ? ? 45.59 26.86 18 3 SER A 12 ? ? 56.94 -22.34 19 3 SER A 40 ? ? -64.93 60.62 20 3 ARG A 41 ? ? -160.96 -20.15 21 3 VAL A 42 ? ? 72.88 171.03 22 3 ILE A 57 ? ? -140.59 15.83 23 3 SER A 62 ? ? -159.16 57.18 24 3 LEU A 79 ? ? -73.12 25.51 25 3 CYS A 80 ? ? -64.12 1.02 26 3 CYS A 82 ? ? 49.91 20.09 27 3 LEU A 86 ? ? 64.48 152.63 28 3 ASP A 98 ? ? -126.24 -56.90 29 3 GLN A 100 ? ? -56.39 46.28 30 3 ASP A 105 ? ? 25.18 -101.27 31 3 GLN A 107 ? ? -68.91 -174.48 32 4 ARG A 10 ? ? 59.46 -165.16 33 4 SER A 12 ? ? -61.41 2.53 34 4 LEU A 37 ? ? -69.74 58.56 35 4 GLU A 38 ? ? 53.00 7.51 36 4 SER A 40 ? ? -132.40 -115.23 37 4 CYS A 82 ? ? 52.78 -176.26 38 4 GLN A 100 ? ? -66.81 46.49 39 4 ASP A 105 ? ? 23.88 -96.96 40 5 ARG A 10 ? ? 58.00 -170.80 41 5 SER A 12 ? ? -35.00 -35.41 42 5 LEU A 37 ? ? 83.59 62.77 43 5 SER A 39 ? ? -83.79 38.87 44 5 SER A 40 ? ? 67.82 -169.76 45 5 GLN A 100 ? ? -55.62 33.43 46 5 GLU A 102 ? ? -49.88 155.52 47 6 GLU A 38 ? ? 55.51 11.53 48 6 SER A 62 ? ? -170.50 27.40 49 6 ASN A 85 ? ? -92.96 58.85 50 6 GLN A 93 ? ? -43.38 156.10 51 6 GLN A 100 ? ? -56.31 18.74 52 6 GLU A 102 ? ? 46.94 -157.74 53 6 ASP A 103 ? ? -163.51 74.47 54 6 ASP A 105 ? ? 26.17 -92.37 55 7 LYS A 9 ? ? -140.11 34.67 56 7 SER A 40 ? ? 63.05 -20.62 57 7 LEU A 79 ? ? -141.32 46.87 58 7 CYS A 82 ? ? 37.75 44.72 59 7 GLN A 93 ? ? -45.21 155.67 60 7 GLN A 100 ? ? -51.94 34.05 61 7 GLU A 102 ? ? -42.21 164.51 62 8 LYS A 9 ? ? -149.69 -52.36 63 8 ASN A 11 ? ? -36.07 125.24 64 8 LEU A 37 ? ? 50.47 -156.25 65 8 VAL A 42 ? ? -44.89 151.91 66 8 LEU A 79 ? ? -140.10 34.29 67 8 CYS A 82 ? ? 53.96 -173.13 68 8 GLN A 93 ? ? -44.25 154.19 69 8 GLN A 100 ? ? -58.99 42.90 70 8 ASP A 105 ? ? 23.26 -96.60 71 9 LYS A 9 ? ? -158.59 -63.63 72 9 ASN A 11 ? ? 42.91 25.74 73 9 SER A 12 ? ? 29.45 64.87 74 9 CYS A 13 ? ? -139.38 -71.88 75 9 SER A 39 ? ? 129.46 -28.08 76 9 VAL A 42 ? ? 46.63 -166.90 77 9 SER A 62 ? ? -144.74 21.55 78 9 CYS A 82 ? ? 53.52 -8.70 79 9 GLN A 93 ? ? -45.29 154.64 80 9 GLN A 100 ? ? 42.88 -70.78 81 9 LEU A 101 ? ? 52.69 -174.41 82 9 GLN A 107 ? ? -126.85 -167.94 83 10 ARG A 10 ? ? 55.02 -143.66 84 10 SER A 12 ? ? 65.57 -1.49 85 10 GLU A 38 ? ? -68.95 86.91 86 10 VAL A 42 ? ? -58.09 172.25 87 10 SER A 62 ? ? -163.04 43.96 88 10 GLN A 93 ? ? -47.15 156.29 89 10 GLN A 100 ? ? -49.49 13.86 90 10 GLU A 102 ? ? 48.08 -161.44 91 10 ASP A 103 ? ? -156.48 77.95 92 10 ASP A 105 ? ? 27.56 -101.70 93 10 GLN A 107 ? ? -67.50 -176.73 94 11 SER A 12 ? ? -33.70 -30.06 95 11 SER A 40 ? ? 66.46 -38.81 96 11 VAL A 42 ? ? -48.29 150.83 97 11 GLN A 60 ? ? -69.46 -175.96 98 11 SER A 62 ? ? -156.91 39.99 99 11 LEU A 79 ? ? -140.75 55.46 100 11 CYS A 82 ? ? 46.59 -10.10 101 11 GLN A 100 ? ? -65.75 23.07 102 11 ASP A 105 ? ? -24.84 85.02 103 12 ARG A 10 ? ? 58.10 -153.66 104 12 VAL A 42 ? ? -56.16 170.89 105 12 SER A 62 ? ? -167.13 42.47 106 12 CYS A 82 ? ? 55.24 173.63 107 12 TRP A 90 ? ? -77.21 24.31 108 12 GLN A 100 ? ? -54.92 44.30 109 12 ASP A 105 ? ? -64.10 81.05 110 13 ASN A 11 ? ? 29.06 101.78 111 13 SER A 12 ? ? -33.28 -33.64 112 13 GLU A 38 ? ? 59.76 16.41 113 13 VAL A 42 ? ? -57.80 170.65 114 13 SER A 62 ? ? -170.48 27.02 115 13 LEU A 79 ? ? -142.20 52.90 116 13 TRP A 99 ? ? -101.36 77.20 117 13 GLN A 100 ? ? -56.24 16.80 118 13 GLU A 102 ? ? 52.11 -155.44 119 13 ASP A 103 ? ? -163.70 57.37 120 14 LYS A 9 ? ? -141.97 34.54 121 14 SER A 12 ? ? -40.44 98.04 122 14 CYS A 13 ? ? -158.35 -84.85 123 14 SER A 40 ? ? 59.45 -12.44 124 14 CYS A 82 ? ? 39.33 43.66 125 14 TRP A 99 ? ? -100.53 77.40 126 14 GLN A 100 ? ? -62.51 33.51 127 14 ASP A 105 ? ? -39.61 96.35 128 15 ARG A 10 ? ? 58.61 -169.31 129 15 ASN A 11 ? ? -47.29 105.99 130 15 SER A 39 ? ? -70.82 30.28 131 15 ARG A 41 ? ? 61.04 -153.54 132 15 CYS A 82 ? ? 60.35 -20.07 133 15 GLN A 93 ? ? -44.29 155.22 134 15 GLN A 100 ? ? 47.19 -68.78 135 15 LEU A 101 ? ? 45.29 -172.73 136 16 LYS A 9 ? ? -142.36 30.00 137 16 LEU A 37 ? ? -151.10 52.99 138 16 GLU A 38 ? ? 59.72 -80.27 139 16 SER A 39 ? ? -169.66 26.56 140 16 LEU A 79 ? ? -147.38 49.44 141 16 GLN A 93 ? ? -49.99 159.55 142 16 LEU A 101 ? ? 38.04 -158.39 143 16 PRO A 104 ? ? -77.21 49.74 144 17 ARG A 10 ? ? 57.51 -160.51 145 17 GLU A 38 ? ? 53.28 8.03 146 17 ARG A 41 ? ? 59.34 -158.51 147 17 SER A 62 ? ? -163.13 19.70 148 17 CYS A 82 ? ? 38.91 45.14 149 17 GLN A 93 ? ? -41.67 154.17 150 17 GLN A 100 ? ? -58.77 22.40 151 17 ASP A 105 ? ? 19.80 -101.21 152 18 ARG A 10 ? ? 62.16 -179.36 153 18 LEU A 79 ? ? -144.27 40.19 154 18 GLN A 100 ? ? -48.03 7.91 155 18 GLU A 102 ? ? 51.01 -160.04 156 18 ASP A 103 ? ? -165.48 70.76 157 18 GLN A 107 ? ? -116.13 -157.62 158 19 LYS A 9 ? ? -152.40 -45.93 159 19 ARG A 10 ? ? -70.05 -167.70 160 19 GLU A 38 ? ? 60.98 -67.43 161 19 SER A 39 ? ? -155.00 40.93 162 19 SER A 62 ? ? -163.43 68.03 163 19 LEU A 79 ? ? -144.50 53.03 164 19 GLN A 100 ? ? -61.33 25.60 165 19 ASP A 105 ? ? 22.90 -99.33 166 20 ARG A 10 ? ? 57.01 -172.44 167 20 ASN A 11 ? ? -49.95 105.36 168 20 SER A 12 ? ? -62.06 0.15 169 20 LEU A 37 ? ? -162.74 118.39 170 20 ASP A 56 ? ? -108.19 -61.50 171 20 ILE A 57 ? ? 56.17 1.41 172 20 SER A 62 ? ? -169.56 22.81 173 20 LEU A 79 ? ? -143.02 41.82 174 20 LEU A 101 ? ? 40.10 -170.56 175 20 ASP A 105 ? ? 20.13 -95.06 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 15 ARG A 14 ? ? 0.089 'SIDE CHAIN' 2 19 TYR A 73 ? ? 0.072 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 2 Y 1 A GLY -2 ? A GLY 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A HIS 0 ? A HIS 3 7 3 Y 1 A GLY -2 ? A GLY 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A HIS 0 ? A HIS 3 10 4 Y 1 A GLY -2 ? A GLY 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A HIS 0 ? A HIS 3 13 5 Y 1 A GLY -2 ? A GLY 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A HIS 0 ? A HIS 3 16 6 Y 1 A GLY -2 ? A GLY 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A HIS 0 ? A HIS 3 19 7 Y 1 A GLY -2 ? A GLY 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A HIS 0 ? A HIS 3 22 8 Y 1 A GLY -2 ? A GLY 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A HIS 0 ? A HIS 3 25 9 Y 1 A GLY -2 ? A GLY 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A HIS 0 ? A HIS 3 28 10 Y 1 A GLY -2 ? A GLY 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A HIS 0 ? A HIS 3 31 11 Y 1 A GLY -2 ? A GLY 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A HIS 0 ? A HIS 3 34 12 Y 1 A GLY -2 ? A GLY 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A HIS 0 ? A HIS 3 37 13 Y 1 A GLY -2 ? A GLY 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A HIS 0 ? A HIS 3 40 14 Y 1 A GLY -2 ? A GLY 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A HIS 0 ? A HIS 3 43 15 Y 1 A GLY -2 ? A GLY 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A HIS 0 ? A HIS 3 46 16 Y 1 A GLY -2 ? A GLY 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A HIS 0 ? A HIS 3 49 17 Y 1 A GLY -2 ? A GLY 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A HIS 0 ? A HIS 3 52 18 Y 1 A GLY -2 ? A GLY 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A HIS 0 ? A HIS 3 55 19 Y 1 A GLY -2 ? A GLY 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A HIS 0 ? A HIS 3 58 20 Y 1 A GLY -2 ? A GLY 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A HIS 0 ? A HIS 3 #