data_2L1B
# 
_entry.id   2L1B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2L1B         
RCSB  RCSB101831   
BMRB  17079        
WWPDB D_1000101831 
# 
_pdbx_database_related.db_id          17079 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2L1B 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-07-27 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kaustov, L.'                          1  
'Lemak, A.'                            2  
'Fares, C.'                            3  
'Gutmanas, A.'                         4  
'Muhandiram, R.'                       5  
'Quang, H.'                            6  
'Loppnau, P.'                          7  
'Min, J.'                              8  
'Edwards, A.'                          9  
'Arrowsmith, C.'                       10 
'Structural Genomics Consortium (SGC)' 11 
# 
_citation.id                        primary 
_citation.title                     'Recognition and specificity determinants of the human cbx chromodomains.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            286 
_citation.page_first                521 
_citation.page_last                 529 
_citation.year                      2011 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21047797 
_citation.pdbx_database_id_DOI      10.1074/jbc.M110.191411 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kaustov, L.'      1  ? 
primary 'Ouyang, H.'       2  ? 
primary 'Amaya, M.'        3  ? 
primary 'Lemak, A.'        4  ? 
primary 'Nady, N.'         5  ? 
primary 'Duan, S.'         6  ? 
primary 'Wasney, G.A.'     7  ? 
primary 'Li, Z.'           8  ? 
primary 'Vedadi, M.'       9  ? 
primary 'Schapira, M.'     10 ? 
primary 'Min, J.'          11 ? 
primary 'Arrowsmith, C.H.' 12 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Chromobox protein homolog 7' 6816.852 1 ? ? 'UNP Residues 7-62'  ? 
2 polymer syn 'Histone H3'                  1515.776 1 ? ? 'UNP Residues 20-34' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE 
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE A ? 
2 'polypeptide(L)' no yes 'QLATKAAR(M3L)SAPATG'                                    QLATKAARKSAPATG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  GLU n 
1 3  GLN n 
1 4  VAL n 
1 5  PHE n 
1 6  ALA n 
1 7  VAL n 
1 8  GLU n 
1 9  SER n 
1 10 ILE n 
1 11 ARG n 
1 12 LYS n 
1 13 LYS n 
1 14 ARG n 
1 15 VAL n 
1 16 ARG n 
1 17 LYS n 
1 18 GLY n 
1 19 LYS n 
1 20 VAL n 
1 21 GLU n 
1 22 TYR n 
1 23 LEU n 
1 24 VAL n 
1 25 LYS n 
1 26 TRP n 
1 27 LYS n 
1 28 GLY n 
1 29 TRP n 
1 30 PRO n 
1 31 PRO n 
1 32 LYS n 
1 33 TYR n 
1 34 SER n 
1 35 THR n 
1 36 TRP n 
1 37 GLU n 
1 38 PRO n 
1 39 GLU n 
1 40 GLU n 
1 41 HIS n 
1 42 ILE n 
1 43 LEU n 
1 44 ASP n 
1 45 PRO n 
1 46 ARG n 
1 47 LEU n 
1 48 VAL n 
1 49 MET n 
1 50 ALA n 
1 51 TYR n 
1 52 GLU n 
1 53 GLU n 
1 54 LYS n 
1 55 GLU n 
1 56 GLU n 
2 1  GLN n 
2 2  LEU n 
2 3  ALA n 
2 4  THR n 
2 5  LYS n 
2 6  ALA n 
2 7  ALA n 
2 8  ARG n 
2 9  M3L n 
2 10 SER n 
2 11 ALA n 
2 12 PRO n 
2 13 ALA n 
2 14 THR n 
2 15 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CBX7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'BL21(DE3) Codon plus RIL (Stratagene)' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3) Codon plus RIL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET28a-mhl 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Xenopus laevis' 
_pdbx_entity_src_syn.organism_common_name   'clawed frog,common platanna,platanna' 
_pdbx_entity_src_syn.ncbi_taxonomy_id       8355 
_pdbx_entity_src_syn.details                'H3K27me3 15-mer peptide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CBX7_HUMAN   O95931 1 EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE 8  ? 
2 UNP Q92133_XENLA Q92133 2 QLATKAARKSAPATG                                         20 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2L1B A 2 ? 56 ? O95931 8  ? 62 ? 2  56 
2 2 2L1B B 1 ? 15 ? Q92133 20 ? 34 ? 19 33 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2L1B 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O95931 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
M3L 'L-peptide linking' n N-TRIMETHYLLYSINE ? 'C9 H21 N2 O2 1' 189.275 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                
1 2  1 '2D 1H-13C HSQC'                
1 3  1 '3D CBCA(CO)NH'                 
1 4  1 '3D HNCO'                       
1 5  1 '3D HNCA'                       
1 6  1 '3D HBHA(CO)NH'                 
1 7  1 '3D 1H-15N NOESY'               
1 8  1 '3D 1H-13C NOESY'               
1 9  1 '3D HCCH-TOCSY'                 
1 10 1 '3D HCCH-TOCSY'                 
1 11 1 '13C/15N-filtered/edited NOESY' 
1 12 1 '3D aro 1H-13C NOESY'           
1 13 1 '3D aro HCCH-TOCSY'             
1 14 1 '3D aro (H)CCH-TOCSY'           
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      300 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;0.5 mM [U-13C; U-15N] protein, 2.7 mM peptide, 10 mM sodium phosphate, 300 mM sodium chloride, 0.5 mM PMSF, 0.5 mM TCEP, 1 mM Benzamidine, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker AVANCE 1 'Bruker Avance' 
500 Varian INOVA  2 'Varian INOVA'  
# 
_pdbx_nmr_refine.entry_id           2L1B 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2L1B 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2L1B 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'(ABACUS)-Grishaev'                                 'chemical shift assignment' ABACUS  ? 1 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA   ? 2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe ? 3 
Goddard                                             'peak picking'              Sparky  ? 4 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS     ? 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2L1B 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2L1B 
_struct.title                     'Solution NMR structure of the chromobox protein Cbx7 with H3K27me3' 
_struct.pdbx_descriptor           'Chromobox protein homolog 7, Histone H3' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2L1B 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATOR' 
_struct_keywords.text            'chromodomain, Structural Genomics, Structural Genomics Consortium, SGC, TRANSCRIPTION REGULATOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 40 ? ILE A 42 ? GLU A 40 ILE A 42 5 ? 3 
HELX_P HELX_P2 2 PRO A 45 ? GLU A 53 ? PRO A 45 GLU A 53 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? B ARG 8 C ? ? ? 1_555 B M3L 9  N ? ? B ARG 26 B M3L 27 1_555 ? ? ? ? ? ? ? 1.336 ? 
covale2 covale both ? B M3L 9 C ? ? ? 1_555 B SER 10 N ? ? B M3L 27 B SER 28 1_555 ? ? ? ? ? ? ? 1.354 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 35 ? PRO A 38 ? THR A 35 PRO A 38 
A 2 LYS A 19 ? TRP A 26 ? LYS A 19 TRP A 26 
A 3 GLN A 3  ? ARG A 16 ? GLN A 3  ARG A 16 
A 4 LYS B 5  ? M3L B 9  ? LYS B 23 M3L B 27 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 35 ? O THR A 35 N VAL A 24 ? N VAL A 24 
A 2 3 O LEU A 23 ? O LEU A 23 N ARG A 11 ? N ARG A 11 
A 3 4 N PHE A 5  ? N PHE A 5  O ALA B 7  ? O ALA B 25 
# 
_atom_sites.entry_id                    2L1B 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  GLU 2  2  2  GLU GLU A . n 
A 1 3  GLN 3  3  3  GLN GLN A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  PHE 5  5  5  PHE PHE A . n 
A 1 6  ALA 6  6  6  ALA ALA A . n 
A 1 7  VAL 7  7  7  VAL VAL A . n 
A 1 8  GLU 8  8  8  GLU GLU A . n 
A 1 9  SER 9  9  9  SER SER A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 LYS 12 12 12 LYS LYS A . n 
A 1 13 LYS 13 13 13 LYS LYS A . n 
A 1 14 ARG 14 14 14 ARG ARG A . n 
A 1 15 VAL 15 15 15 VAL VAL A . n 
A 1 16 ARG 16 16 16 ARG ARG A . n 
A 1 17 LYS 17 17 17 LYS LYS A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 VAL 20 20 20 VAL VAL A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 TYR 22 22 22 TYR TYR A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 TRP 26 26 26 TRP TRP A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 TRP 29 29 29 TRP TRP A . n 
A 1 30 PRO 30 30 30 PRO PRO A . n 
A 1 31 PRO 31 31 31 PRO PRO A . n 
A 1 32 LYS 32 32 32 LYS LYS A . n 
A 1 33 TYR 33 33 33 TYR TYR A . n 
A 1 34 SER 34 34 34 SER SER A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 TRP 36 36 36 TRP TRP A . n 
A 1 37 GLU 37 37 37 GLU GLU A . n 
A 1 38 PRO 38 38 38 PRO PRO A . n 
A 1 39 GLU 39 39 39 GLU GLU A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 HIS 41 41 41 HIS HIS A . n 
A 1 42 ILE 42 42 42 ILE ILE A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 ASP 44 44 44 ASP ASP A . n 
A 1 45 PRO 45 45 45 PRO PRO A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 LEU 47 47 47 LEU LEU A . n 
A 1 48 VAL 48 48 48 VAL VAL A . n 
A 1 49 MET 49 49 49 MET MET A . n 
A 1 50 ALA 50 50 50 ALA ALA A . n 
A 1 51 TYR 51 51 51 TYR TYR A . n 
A 1 52 GLU 52 52 52 GLU GLU A . n 
A 1 53 GLU 53 53 53 GLU GLU A . n 
A 1 54 LYS 54 54 54 LYS LYS A . n 
A 1 55 GLU 55 55 55 GLU GLU A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
B 2 1  GLN 1  19 19 GLN GLN B . n 
B 2 2  LEU 2  20 20 LEU LEU B . n 
B 2 3  ALA 3  21 21 ALA ALA B . n 
B 2 4  THR 4  22 22 THR THR B . n 
B 2 5  LYS 5  23 23 LYS LYS B . n 
B 2 6  ALA 6  24 24 ALA ALA B . n 
B 2 7  ALA 7  25 25 ALA ALA B . n 
B 2 8  ARG 8  26 26 ARG ARG B . n 
B 2 9  M3L 9  27 27 M3L M3L B . n 
B 2 10 SER 10 28 28 SER SER B . n 
B 2 11 ALA 11 29 29 ALA ALA B . n 
B 2 12 PRO 12 30 30 PRO PRO B . n 
B 2 13 ALA 13 31 31 ALA ALA B . n 
B 2 14 THR 14 32 32 THR THR B . n 
B 2 15 GLY 15 33 33 GLY GLY B . n 
# 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     SGC 
_pdbx_SG_project.project_name          ? 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    M3L 
_pdbx_struct_mod_residue.label_seq_id     9 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     M3L 
_pdbx_struct_mod_residue.auth_seq_id      27 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LYS 
_pdbx_struct_mod_residue.details          N-TRIMETHYLLYSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-08-25 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2020-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_database_status  
2 3 'Structure model' pdbx_nmr_software     
3 3 'Structure model' pdbx_nmr_spectrometer 
4 3 'Structure model' struct_conn           
5 3 'Structure model' struct_ref_seq_dif    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_database_status.status_code_cs' 
2 3 'Structure model' '_pdbx_nmr_software.name'              
3 3 'Structure model' '_pdbx_nmr_spectrometer.model'         
4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
5 3 'Structure model' '_struct_ref_seq_dif.details'          
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
entity_1-1           0.5 ? mM '[U-13C; U-15N]' 1 
entity_2-2           2.7 ? mM ?                1 
'sodium phosphate-3' 10  ? mM ?                1 
'sodium chloride-4'  300 ? mM ?                1 
PMSF-5               0.5 ? mM ?                1 
TCEP-6               0.5 ? mM ?                1 
Benzamidine-7        1   ? mM ?                1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  SER A 9  ? ? -174.14 -172.28 
2  1  PRO A 31 ? ? -69.42  5.54    
3  1  LEU A 43 ? ? -89.44  -79.47  
4  1  ALA B 29 ? ? 70.70   131.63  
5  2  LEU A 23 ? ? -69.26  90.58   
6  2  TRP A 36 ? ? -68.81  85.40   
7  2  LEU A 43 ? ? -86.34  -71.94  
8  2  LEU B 20 ? ? 62.95   93.83   
9  2  SER B 28 ? ? 76.45   161.08  
10 2  ALA B 29 ? ? 66.36   90.24   
11 2  ALA B 31 ? ? -67.06  95.33   
12 3  GLU A 55 ? ? 66.92   81.14   
13 3  THR B 32 ? ? -155.86 21.87   
14 4  TRP A 36 ? ? -68.80  83.49   
15 4  LEU A 43 ? ? -87.91  -70.73  
16 4  SER B 28 ? ? 178.10  147.47  
17 4  PRO B 30 ? ? -51.75  108.92  
18 5  LEU A 23 ? ? -68.63  89.09   
19 5  TRP A 36 ? ? -69.89  80.62   
20 5  LEU A 43 ? ? -78.07  -72.14  
21 5  M3L B 27 ? ? -100.19 70.46   
22 5  PRO B 30 ? ? -58.14  103.28  
23 6  SER A 9  ? ? -175.07 -175.84 
24 6  LEU A 23 ? ? -68.82  86.86   
25 6  M3L B 27 ? ? -109.21 67.88   
26 6  SER B 28 ? ? -57.10  98.42   
27 7  GLU A 2  ? ? -107.39 -80.94  
28 7  LEU A 23 ? ? -67.70  94.17   
29 7  LEU A 43 ? ? -84.13  -77.67  
30 7  PRO B 30 ? ? -46.11  100.53  
31 8  GLU A 2  ? ? -68.24  93.00   
32 8  SER A 9  ? ? -170.91 -174.61 
33 8  LEU A 23 ? ? -68.09  88.02   
34 8  LEU A 43 ? ? -82.69  -77.53  
35 8  THR B 22 ? ? -69.53  96.32   
36 8  ALA B 31 ? ? 78.17   -45.18  
37 9  SER A 9  ? ? -175.19 -171.53 
38 9  LEU A 23 ? ? -69.54  91.52   
39 9  LEU A 43 ? ? -82.10  -70.62  
40 9  GLU A 53 ? ? -89.50  49.78   
41 9  M3L B 27 ? ? -106.91 71.54   
42 9  THR B 32 ? ? -154.21 -16.90  
43 10 GLU A 2  ? ? -103.59 68.57   
44 10 LEU A 23 ? ? -65.57  89.27   
45 10 LEU A 43 ? ? -96.73  -69.15  
46 10 ALA B 21 ? ? -99.15  33.07   
47 10 SER B 28 ? ? -67.74  77.04   
48 11 LEU A 43 ? ? -75.68  -78.93  
49 11 THR B 22 ? ? -91.07  43.04   
50 11 ALA B 25 ? ? -102.90 -167.65 
51 11 M3L B 27 ? ? -104.53 64.46   
52 12 SER A 9  ? ? 177.94  169.51  
53 12 LEU A 43 ? ? -88.20  -70.47  
54 12 GLU A 55 ? ? 59.84   15.17   
55 12 SER B 28 ? ? -62.41  96.05   
56 13 TRP A 36 ? ? -68.94  82.26   
57 13 LEU B 20 ? ? 67.57   98.16   
58 13 SER B 28 ? ? 72.59   -89.24  
59 13 ALA B 29 ? ? 38.11   104.09  
60 13 PRO B 30 ? ? -53.15  102.68  
61 13 THR B 32 ? ? -64.32  93.90   
62 14 SER A 9  ? ? -173.60 -172.57 
63 14 LEU A 43 ? ? -90.85  -67.22  
64 14 GLU A 55 ? ? 60.46   96.06   
65 14 LEU B 20 ? ? -107.89 62.35   
66 15 SER A 9  ? ? -167.59 -169.34 
67 15 LEU A 43 ? ? -87.34  -71.12  
68 15 GLU A 55 ? ? 65.12   98.70   
69 15 THR B 22 ? ? -67.62  84.19   
70 16 ARG A 14 ? ? -171.45 -174.24 
71 16 LEU A 43 ? ? -81.23  -82.57  
72 16 GLU A 55 ? ? 57.16   77.88   
73 17 PRO A 31 ? ? -68.22  0.56    
74 17 LEU A 43 ? ? -81.98  -77.62  
75 17 SER B 28 ? ? 94.40   158.17  
76 18 SER A 9  ? ? -175.46 -170.12 
77 18 LEU A 43 ? ? -85.31  -72.79  
78 18 M3L B 27 ? ? -108.02 62.98   
79 18 ALA B 31 ? ? 65.88   -72.06  
80 19 SER A 9  ? ? 178.76  -175.89 
81 19 LEU A 23 ? ? -67.36  97.11   
82 19 LEU A 43 ? ? -83.45  -73.89  
83 19 LYS B 23 ? ? -118.21 -165.92 
84 20 ALA B 21 ? ? -67.50  88.33   
85 20 THR B 32 ? ? 56.52   18.37   
#