data_2L1Q # _entry.id 2L1Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L1Q RCSB RCSB101846 WWPDB D_1000101846 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L1Q _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-08-03 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # _audit_author.name 'Clark, R.J.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Structural and functional analysis of human liver-expressed antimicrobial peptide 2.' _citation.journal_abbrev Chembiochem _citation.journal_volume 11 _citation.page_first 2148 _citation.page_last 2157 _citation.year 2010 _citation.journal_id_ASTM ? _citation.country GE _citation.journal_id_ISSN 1439-7633 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20845358 _citation.pdbx_database_id_DOI 10.1002/cbic.201000400 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Henriques, S.T.' 1 ? primary 'Tan, C.C.' 2 ? primary 'Craik, D.J.' 3 ? primary 'Clark, R.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Liver-expressed antimicrobial peptide 2' _entity.formula_weight 4593.370 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE _entity_poly.pdbx_seq_one_letter_code_can MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 PRO n 1 4 PHE n 1 5 TRP n 1 6 ARG n 1 7 GLY n 1 8 VAL n 1 9 SER n 1 10 LEU n 1 11 ARG n 1 12 PRO n 1 13 ILE n 1 14 GLY n 1 15 ALA n 1 16 SER n 1 17 CYS n 1 18 ARG n 1 19 ASP n 1 20 ASP n 1 21 SER n 1 22 GLU n 1 23 CYS n 1 24 ILE n 1 25 THR n 1 26 ARG n 1 27 LEU n 1 28 CYS n 1 29 ARG n 1 30 LYS n 1 31 ARG n 1 32 ARG n 1 33 CYS n 1 34 SER n 1 35 LEU n 1 36 SER n 1 37 VAL n 1 38 ALA n 1 39 GLN n 1 40 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LEAP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEAP2_HUMAN _struct_ref.pdbx_db_accession Q969E1 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE _struct_ref.pdbx_align_begin 38 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L1Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q969E1 _struct_ref_seq.db_align_beg 38 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 '2D DQF-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 3.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM leap2-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L1Q _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ;Structures were calculated using torsion angle dynamics and subsequently refined by cartesian coordinate dynamics and powell minimization in explicit solvent using CNS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L1Q _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L1Q _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 1 Goddard 'chemical shift assignment' Sparky ? 2 'Bruker Biospin' collection TopSpin ? 3 'Bruker Biospin' processing TopSpin ? 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L1Q _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L1Q _struct.title 'Solution structure of human Liver Expressed Antimicrobial Peptide 2' _struct.pdbx_descriptor 'Liver-expressed antimicrobial peptide 2' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L1Q _struct_keywords.pdbx_keywords 'ANTIMICROBIAL PROTEIN' _struct_keywords.text 'polypeptide, disulfides, ANTIMICROBIAL PROTEIN, LEAP-2' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 19 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id CYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 23 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 19 _struct_conf.end_auth_comp_id CYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 23 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 17 A CYS 28 1_555 ? ? ? ? ? ? ? 2.031 ? disulf2 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 23 A CYS 33 1_555 ? ? ? ? ? ? ? 2.033 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 28 ? ARG A 29 ? CYS A 28 ARG A 29 A 2 ARG A 32 ? CYS A 33 ? ARG A 32 CYS A 33 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ARG _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 32 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 32 # _atom_sites.entry_id 2L1Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLU 40 40 40 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-09-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-01-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_volume' 2 3 'Structure model' '_citation.page_first' 3 3 'Structure model' '_citation.page_last' 4 3 'Structure model' '_citation.pdbx_database_id_PubMed' 5 3 'Structure model' '_citation.title' 6 3 'Structure model' '_citation_author.name' 7 3 'Structure model' '_pdbx_nmr_software.name' 8 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component leap2-1 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ2 A LYS 30 ? ? O A GLU 40 ? ? 1.59 2 3 HH21 A ARG 29 ? ? OE2 A GLU 40 ? ? 1.57 3 3 HZ1 A LYS 30 ? ? OE1 A GLU 40 ? ? 1.58 4 3 HZ2 A LYS 30 ? ? OXT A GLU 40 ? ? 1.58 5 4 HZ1 A LYS 30 ? ? OE1 A GLU 40 ? ? 1.56 6 4 HZ3 A LYS 30 ? ? O A GLU 40 ? ? 1.58 7 5 HH12 A ARG 29 ? ? OE1 A GLU 40 ? ? 1.56 8 5 HZ2 A LYS 30 ? ? OE2 A GLU 40 ? ? 1.56 9 7 HZ3 A LYS 30 ? ? OXT A GLU 40 ? ? 1.51 10 9 HZ3 A LYS 30 ? ? OXT A GLU 40 ? ? 1.57 11 10 HZ2 A LYS 30 ? ? OE1 A GLU 40 ? ? 1.54 12 10 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.57 13 10 HH21 A ARG 11 ? ? OE2 A GLU 22 ? ? 1.59 14 11 H2 A MET 1 ? ? OE2 A GLU 40 ? ? 1.55 15 11 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.59 16 13 HZ1 A LYS 30 ? ? OE2 A GLU 40 ? ? 1.58 17 13 OD1 A ASP 19 ? ? HG A SER 21 ? ? 1.59 18 14 HH12 A ARG 29 ? ? OE2 A GLU 40 ? ? 1.58 19 15 HZ1 A LYS 30 ? ? OE1 A GLU 40 ? ? 1.58 20 16 HH12 A ARG 29 ? ? O A GLU 40 ? ? 1.60 21 17 HH22 A ARG 29 ? ? OXT A GLU 40 ? ? 1.60 22 20 HZ1 A LYS 30 ? ? OE1 A GLU 40 ? ? 1.55 23 20 HH21 A ARG 29 ? ? O A GLU 40 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -154.82 -54.96 2 1 ARG A 18 ? ? -132.53 -31.81 3 1 LEU A 35 ? ? -79.93 -157.25 4 2 ARG A 6 ? ? -150.06 33.10 5 2 ARG A 18 ? ? -143.66 -2.44 6 2 ASP A 19 ? ? -177.89 143.60 7 2 LEU A 35 ? ? -85.90 -157.17 8 2 ALA A 38 ? ? -108.83 56.40 9 3 LEU A 10 ? ? -132.50 -154.52 10 3 ARG A 18 ? ? -130.52 -35.10 11 3 LEU A 35 ? ? -82.47 -155.97 12 3 VAL A 37 ? ? -113.52 62.28 13 3 GLN A 39 ? ? -143.91 22.97 14 4 LEU A 10 ? ? -127.58 -165.10 15 4 LEU A 35 ? ? -81.98 -158.80 16 4 SER A 36 ? ? -70.00 63.63 17 5 TRP A 5 ? ? -154.53 20.41 18 5 LEU A 10 ? ? -119.53 -168.24 19 5 LEU A 35 ? ? -95.72 -159.39 20 5 GLN A 39 ? ? -168.26 114.10 21 6 LEU A 10 ? ? -138.54 -153.80 22 6 LEU A 35 ? ? -77.46 -156.19 23 6 SER A 36 ? ? -70.75 44.38 24 6 GLN A 39 ? ? -162.02 29.68 25 7 PHE A 4 ? ? -77.29 34.44 26 7 LEU A 10 ? ? -142.42 -145.96 27 8 LEU A 10 ? ? -117.63 -167.78 28 8 LEU A 35 ? ? -85.01 -150.94 29 9 LEU A 35 ? ? -79.49 -167.12 30 9 SER A 36 ? ? -77.86 38.74 31 10 TRP A 5 ? ? -172.98 -50.28 32 10 LEU A 10 ? ? -159.62 -150.57 33 10 LEU A 35 ? ? -90.13 -157.25 34 10 VAL A 37 ? ? -117.05 60.18 35 11 SER A 9 ? ? -178.61 -144.71 36 11 LEU A 10 ? ? -84.07 -140.87 37 11 LEU A 35 ? ? -108.46 -160.23 38 11 SER A 36 ? ? -67.65 70.09 39 11 ALA A 38 ? ? -163.80 -53.41 40 11 GLN A 39 ? ? -161.70 -64.77 41 12 SER A 9 ? ? -157.27 -152.22 42 12 LEU A 10 ? ? -82.39 -151.45 43 12 PRO A 12 ? ? -64.34 -171.74 44 12 ILE A 13 ? ? -58.14 -72.46 45 12 SER A 36 ? ? -76.26 42.01 46 12 VAL A 37 ? ? -78.28 43.41 47 12 ALA A 38 ? ? -162.80 23.86 48 12 GLN A 39 ? ? -157.98 -41.05 49 13 PHE A 4 ? ? -118.72 76.59 50 13 LEU A 10 ? ? -138.78 -155.01 51 13 GLN A 39 ? ? -103.66 45.87 52 14 PHE A 4 ? ? -102.91 70.32 53 14 ARG A 6 ? ? -115.20 52.01 54 14 SER A 9 ? ? -165.24 -126.41 55 14 LEU A 10 ? ? -81.18 -151.24 56 14 PRO A 12 ? ? -63.65 -178.72 57 14 ARG A 18 ? ? -133.78 -31.62 58 14 LEU A 35 ? ? -114.91 -161.26 59 14 SER A 36 ? ? -76.28 44.79 60 15 THR A 2 ? ? -126.86 -58.11 61 15 PHE A 4 ? ? -131.85 -47.11 62 15 TRP A 5 ? ? -83.07 41.23 63 15 LEU A 10 ? ? -113.98 -169.37 64 15 ARG A 18 ? ? -133.95 -34.25 65 15 LEU A 35 ? ? -80.71 -156.99 66 16 SER A 9 ? ? 179.65 -41.55 67 16 LEU A 10 ? ? -141.14 -155.78 68 16 LEU A 35 ? ? -86.96 -147.75 69 17 LEU A 10 ? ? -147.55 -155.74 70 17 PRO A 12 ? ? -75.22 -163.61 71 17 ARG A 18 ? ? -130.29 -34.52 72 17 LEU A 35 ? ? -77.31 -161.79 73 17 SER A 36 ? ? -74.65 37.99 74 18 LEU A 10 ? ? -175.05 -156.79 75 18 ARG A 18 ? ? -132.66 -37.85 76 18 VAL A 37 ? ? -93.85 40.47 77 18 GLN A 39 ? ? -118.09 54.60 78 19 LEU A 10 ? ? -120.95 -165.52 79 19 ARG A 18 ? ? -134.85 -31.55 80 19 LEU A 35 ? ? -80.72 -158.27 81 19 SER A 36 ? ? -72.69 42.09 82 19 ALA A 38 ? ? -115.42 56.23 83 20 PHE A 4 ? ? -110.21 72.80 84 20 LEU A 10 ? ? -167.22 -148.80 85 20 PRO A 12 ? ? -73.42 -159.20 86 20 ARG A 18 ? ? -134.90 -35.14 87 20 LEU A 35 ? ? -101.20 -158.93 #