data_2L22 # _entry.id 2L22 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L22 RCSB RCSB101858 WWPDB D_1000101858 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L22 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dong, X.' 1 'Williams, C.' 2 'Crump, M.P.' 3 'Wattana-amorn, P.' 4 # _citation.id primary _citation.title 'A conserved motif flags acyl carrier proteins for beta-branching in polyketide synthesis.' _citation.journal_abbrev Nat.Chem.Biol. _citation.journal_volume 9 _citation.page_first 685 _citation.page_last 692 _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1552-4450 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24056399 _citation.pdbx_database_id_DOI 10.1038/nchembio.1342 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Haines, A.S.' 1 primary 'Dong, X.' 2 primary 'Song, Z.' 3 primary 'Farmer, R.' 4 primary 'Williams, C.' 5 primary 'Hothersall, J.' 6 primary 'Poskon, E.' 7 primary 'Wattana-Amorn, P.' 8 primary 'Stephens, E.R.' 9 primary 'Yamada, E.' 10 primary 'Gurney, R.' 11 primary 'Takebayashi, Y.' 12 primary 'Masschelein, J.' 13 primary 'Cox, R.J.' 14 primary 'Lavigne, R.' 15 primary 'Willis, C.L.' 16 primary 'Simpson, T.J.' 17 primary 'Crosby, J.' 18 primary 'Winn, P.J.' 19 primary 'Thomas, C.M.' 20 primary 'Crump, M.P.' 21 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Mupirocin didomain Acyl Carrier Protein' _entity.formula_weight 23764.719 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMVADDECAQFLRQSLAAMLYCEPGQIRDGSRFLELGLDSVIAAQWIREINKHYQLKIPAD GIYTYPVFKAFTQWVGTQLQPTQATAAPVQREPVATAPQPGAQASAQRESIQDYLKQSLGELLFLDPGQLRSGAQFLDLG MDSVTGTQWMRGVSRHFSIQLAADAIYTWPTLKSLADEVDRRVQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMVADDECAQFLRQSLAAMLYCEPGQIRDGSRFLELGLDSVIAAQWIREINKHYQLKIPAD GIYTYPVFKAFTQWVGTQLQPTQATAAPVQREPVATAPQPGAQASAQRESIQDYLKQSLGELLFLDPGQLRSGAQFLDLG MDSVTGTQWMRGVSRHFSIQLAADAIYTWPTLKSLADEVDRRVQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 VAL n 1 23 ALA n 1 24 ASP n 1 25 ASP n 1 26 GLU n 1 27 CYS n 1 28 ALA n 1 29 GLN n 1 30 PHE n 1 31 LEU n 1 32 ARG n 1 33 GLN n 1 34 SER n 1 35 LEU n 1 36 ALA n 1 37 ALA n 1 38 MET n 1 39 LEU n 1 40 TYR n 1 41 CYS n 1 42 GLU n 1 43 PRO n 1 44 GLY n 1 45 GLN n 1 46 ILE n 1 47 ARG n 1 48 ASP n 1 49 GLY n 1 50 SER n 1 51 ARG n 1 52 PHE n 1 53 LEU n 1 54 GLU n 1 55 LEU n 1 56 GLY n 1 57 LEU n 1 58 ASP n 1 59 SER n 1 60 VAL n 1 61 ILE n 1 62 ALA n 1 63 ALA n 1 64 GLN n 1 65 TRP n 1 66 ILE n 1 67 ARG n 1 68 GLU n 1 69 ILE n 1 70 ASN n 1 71 LYS n 1 72 HIS n 1 73 TYR n 1 74 GLN n 1 75 LEU n 1 76 LYS n 1 77 ILE n 1 78 PRO n 1 79 ALA n 1 80 ASP n 1 81 GLY n 1 82 ILE n 1 83 TYR n 1 84 THR n 1 85 TYR n 1 86 PRO n 1 87 VAL n 1 88 PHE n 1 89 LYS n 1 90 ALA n 1 91 PHE n 1 92 THR n 1 93 GLN n 1 94 TRP n 1 95 VAL n 1 96 GLY n 1 97 THR n 1 98 GLN n 1 99 LEU n 1 100 GLN n 1 101 PRO n 1 102 THR n 1 103 GLN n 1 104 ALA n 1 105 THR n 1 106 ALA n 1 107 ALA n 1 108 PRO n 1 109 VAL n 1 110 GLN n 1 111 ARG n 1 112 GLU n 1 113 PRO n 1 114 VAL n 1 115 ALA n 1 116 THR n 1 117 ALA n 1 118 PRO n 1 119 GLN n 1 120 PRO n 1 121 GLY n 1 122 ALA n 1 123 GLN n 1 124 ALA n 1 125 SER n 1 126 ALA n 1 127 GLN n 1 128 ARG n 1 129 GLU n 1 130 SER n 1 131 ILE n 1 132 GLN n 1 133 ASP n 1 134 TYR n 1 135 LEU n 1 136 LYS n 1 137 GLN n 1 138 SER n 1 139 LEU n 1 140 GLY n 1 141 GLU n 1 142 LEU n 1 143 LEU n 1 144 PHE n 1 145 LEU n 1 146 ASP n 1 147 PRO n 1 148 GLY n 1 149 GLN n 1 150 LEU n 1 151 ARG n 1 152 SER n 1 153 GLY n 1 154 ALA n 1 155 GLN n 1 156 PHE n 1 157 LEU n 1 158 ASP n 1 159 LEU n 1 160 GLY n 1 161 MET n 1 162 ASP n 1 163 SER n 1 164 VAL n 1 165 THR n 1 166 GLY n 1 167 THR n 1 168 GLN n 1 169 TRP n 1 170 MET n 1 171 ARG n 1 172 GLY n 1 173 VAL n 1 174 SER n 1 175 ARG n 1 176 HIS n 1 177 PHE n 1 178 SER n 1 179 ILE n 1 180 GLN n 1 181 LEU n 1 182 ALA n 1 183 ALA n 1 184 ASP n 1 185 ALA n 1 186 ILE n 1 187 TYR n 1 188 THR n 1 189 TRP n 1 190 PRO n 1 191 THR n 1 192 LEU n 1 193 LYS n 1 194 SER n 1 195 LEU n 1 196 ALA n 1 197 ASP n 1 198 GLU n 1 199 VAL n 1 200 ASP n 1 201 ARG n 1 202 ARG n 1 203 VAL n 1 204 GLN n 1 205 LEU n 1 206 GLU n 1 207 HIS n 1 208 HIS n 1 209 HIS n 1 210 HIS n 1 211 HIS n 1 212 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene mmpI _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'NCIMB 10586' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas fluorescens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 294 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8RL76_PSEFL _struct_ref.pdbx_db_accession Q8RL76 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VADDECAQFLRQSLAAMLYCEPGQIRDGSRFLELGLDSVIAAQWIREINKHYQLKIPADGIYTYPVFKAFTQWVGTQLQP TQATAAPVQREPVATAPQPGAQASAQRESIQDYLKQSLGELLFLDPGQLRSGAQFLDLGMDSVTGTQWMRGVSRHFSIQL AADAIYTWPTLKSLADEVDRRVQ ; _struct_ref.pdbx_align_begin 2627 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L22 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8RL76 _struct_ref_seq.db_align_beg 2627 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2809 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L22 MET A 1 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -20 1 1 2L22 GLY A 2 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -19 2 1 2L22 SER A 3 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -18 3 1 2L22 SER A 4 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -17 4 1 2L22 HIS A 5 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -16 5 1 2L22 HIS A 6 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -15 6 1 2L22 HIS A 7 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -14 7 1 2L22 HIS A 8 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -13 8 1 2L22 HIS A 9 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -12 9 1 2L22 HIS A 10 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -11 10 1 2L22 SER A 11 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -10 11 1 2L22 SER A 12 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -9 12 1 2L22 GLY A 13 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -8 13 1 2L22 LEU A 14 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -7 14 1 2L22 VAL A 15 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -6 15 1 2L22 PRO A 16 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -5 16 1 2L22 ARG A 17 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -4 17 1 2L22 GLY A 18 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -3 18 1 2L22 SER A 19 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -2 19 1 2L22 HIS A 20 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' -1 20 1 2L22 MET A 21 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 0 21 1 2L22 LEU A 205 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 184 22 1 2L22 GLU A 206 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 185 23 1 2L22 HIS A 207 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 186 24 1 2L22 HIS A 208 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 187 25 1 2L22 HIS A 209 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 188 26 1 2L22 HIS A 210 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 189 27 1 2L22 HIS A 211 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 190 28 1 2L22 HIS A 212 ? UNP Q8RL76 ? ? 'EXPRESSION TAG' 191 29 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCO' 1 4 1 '3D 1H-15N TOCSY' 1 5 1 '3D 1H-13C NOESY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '20 mM sodium phosphate, 5 mM DTT, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model VNMRS _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian VNMRS' # _pdbx_nmr_refine.entry_id 2L22 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L22 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L22 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_software.authors ;Linge, O'Donoghue and Nilges ; _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name ARIA _pdbx_nmr_software.version 2.2 _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L22 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L22 _struct.title 'Mupirocin didomain ACP' _struct.pdbx_descriptor MmpI _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L22 _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' _struct_keywords.text 'acyl carrier protein, mupirocin, BIOSYNTHETIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 25 ? LEU A 39 ? ASP A 4 LEU A 18 1 ? 15 HELX_P HELX_P2 2 ARG A 51 ? GLY A 56 ? ARG A 30 GLY A 35 1 ? 6 HELX_P HELX_P3 3 ASP A 58 ? TYR A 73 ? ASP A 37 TYR A 52 1 ? 16 HELX_P HELX_P4 4 ASP A 80 ? TYR A 85 ? ASP A 59 TYR A 64 1 ? 6 HELX_P HELX_P5 5 VAL A 87 ? THR A 97 ? VAL A 66 THR A 76 1 ? 11 HELX_P HELX_P6 6 SER A 125 ? PHE A 144 ? SER A 104 PHE A 123 1 ? 20 HELX_P HELX_P7 7 GLN A 155 ? GLY A 160 ? GLN A 134 GLY A 139 5 ? 6 HELX_P HELX_P8 8 SER A 163 ? PHE A 177 ? SER A 142 PHE A 156 1 ? 15 HELX_P HELX_P9 9 ALA A 182 ? TRP A 189 ? ALA A 161 TRP A 168 5 ? 8 HELX_P HELX_P10 10 THR A 191 ? GLN A 204 ? THR A 170 GLN A 183 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2L22 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -20 ? ? ? A . n A 1 2 GLY 2 -19 ? ? ? A . n A 1 3 SER 3 -18 ? ? ? A . n A 1 4 SER 4 -17 ? ? ? A . n A 1 5 HIS 5 -16 ? ? ? A . n A 1 6 HIS 6 -15 ? ? ? A . n A 1 7 HIS 7 -14 ? ? ? A . n A 1 8 HIS 8 -13 ? ? ? A . n A 1 9 HIS 9 -12 ? ? ? A . n A 1 10 HIS 10 -11 ? ? ? A . n A 1 11 SER 11 -10 ? ? ? A . n A 1 12 SER 12 -9 ? ? ? A . n A 1 13 GLY 13 -8 ? ? ? A . n A 1 14 LEU 14 -7 ? ? ? A . n A 1 15 VAL 15 -6 ? ? ? A . n A 1 16 PRO 16 -5 ? ? ? A . n A 1 17 ARG 17 -4 ? ? ? A . n A 1 18 GLY 18 -3 ? ? ? A . n A 1 19 SER 19 -2 ? ? ? A . n A 1 20 HIS 20 -1 ? ? ? A . n A 1 21 MET 21 0 ? ? ? A . n A 1 22 VAL 22 1 1 VAL VAL A . n A 1 23 ALA 23 2 2 ALA ALA A . n A 1 24 ASP 24 3 3 ASP ASP A . n A 1 25 ASP 25 4 4 ASP ASP A . n A 1 26 GLU 26 5 5 GLU GLU A . n A 1 27 CYS 27 6 6 CYS CYS A . n A 1 28 ALA 28 7 7 ALA ALA A . n A 1 29 GLN 29 8 8 GLN GLN A . n A 1 30 PHE 30 9 9 PHE PHE A . n A 1 31 LEU 31 10 10 LEU LEU A . n A 1 32 ARG 32 11 11 ARG ARG A . n A 1 33 GLN 33 12 12 GLN GLN A . n A 1 34 SER 34 13 13 SER SER A . n A 1 35 LEU 35 14 14 LEU LEU A . n A 1 36 ALA 36 15 15 ALA ALA A . n A 1 37 ALA 37 16 16 ALA ALA A . n A 1 38 MET 38 17 17 MET MET A . n A 1 39 LEU 39 18 18 LEU LEU A . n A 1 40 TYR 40 19 19 TYR TYR A . n A 1 41 CYS 41 20 20 CYS CYS A . n A 1 42 GLU 42 21 21 GLU GLU A . n A 1 43 PRO 43 22 22 PRO PRO A . n A 1 44 GLY 44 23 23 GLY GLY A . n A 1 45 GLN 45 24 24 GLN GLN A . n A 1 46 ILE 46 25 25 ILE ILE A . n A 1 47 ARG 47 26 26 ARG ARG A . n A 1 48 ASP 48 27 27 ASP ASP A . n A 1 49 GLY 49 28 28 GLY GLY A . n A 1 50 SER 50 29 29 SER SER A . n A 1 51 ARG 51 30 30 ARG ARG A . n A 1 52 PHE 52 31 31 PHE PHE A . n A 1 53 LEU 53 32 32 LEU LEU A . n A 1 54 GLU 54 33 33 GLU GLU A . n A 1 55 LEU 55 34 34 LEU LEU A . n A 1 56 GLY 56 35 35 GLY GLY A . n A 1 57 LEU 57 36 36 LEU LEU A . n A 1 58 ASP 58 37 37 ASP ASP A . n A 1 59 SER 59 38 38 SER SER A . n A 1 60 VAL 60 39 39 VAL VAL A . n A 1 61 ILE 61 40 40 ILE ILE A . n A 1 62 ALA 62 41 41 ALA ALA A . n A 1 63 ALA 63 42 42 ALA ALA A . n A 1 64 GLN 64 43 43 GLN GLN A . n A 1 65 TRP 65 44 44 TRP TRP A . n A 1 66 ILE 66 45 45 ILE ILE A . n A 1 67 ARG 67 46 46 ARG ARG A . n A 1 68 GLU 68 47 47 GLU GLU A . n A 1 69 ILE 69 48 48 ILE ILE A . n A 1 70 ASN 70 49 49 ASN ASN A . n A 1 71 LYS 71 50 50 LYS LYS A . n A 1 72 HIS 72 51 51 HIS HIS A . n A 1 73 TYR 73 52 52 TYR TYR A . n A 1 74 GLN 74 53 53 GLN GLN A . n A 1 75 LEU 75 54 54 LEU LEU A . n A 1 76 LYS 76 55 55 LYS LYS A . n A 1 77 ILE 77 56 56 ILE ILE A . n A 1 78 PRO 78 57 57 PRO PRO A . n A 1 79 ALA 79 58 58 ALA ALA A . n A 1 80 ASP 80 59 59 ASP ASP A . n A 1 81 GLY 81 60 60 GLY GLY A . n A 1 82 ILE 82 61 61 ILE ILE A . n A 1 83 TYR 83 62 62 TYR TYR A . n A 1 84 THR 84 63 63 THR THR A . n A 1 85 TYR 85 64 64 TYR TYR A . n A 1 86 PRO 86 65 65 PRO PRO A . n A 1 87 VAL 87 66 66 VAL VAL A . n A 1 88 PHE 88 67 67 PHE PHE A . n A 1 89 LYS 89 68 68 LYS LYS A . n A 1 90 ALA 90 69 69 ALA ALA A . n A 1 91 PHE 91 70 70 PHE PHE A . n A 1 92 THR 92 71 71 THR THR A . n A 1 93 GLN 93 72 72 GLN GLN A . n A 1 94 TRP 94 73 73 TRP TRP A . n A 1 95 VAL 95 74 74 VAL VAL A . n A 1 96 GLY 96 75 75 GLY GLY A . n A 1 97 THR 97 76 76 THR THR A . n A 1 98 GLN 98 77 77 GLN GLN A . n A 1 99 LEU 99 78 78 LEU LEU A . n A 1 100 GLN 100 79 79 GLN GLN A . n A 1 101 PRO 101 80 80 PRO PRO A . n A 1 102 THR 102 81 81 THR THR A . n A 1 103 GLN 103 82 82 GLN GLN A . n A 1 104 ALA 104 83 83 ALA ALA A . n A 1 105 THR 105 84 84 THR THR A . n A 1 106 ALA 106 85 85 ALA ALA A . n A 1 107 ALA 107 86 86 ALA ALA A . n A 1 108 PRO 108 87 87 PRO PRO A . n A 1 109 VAL 109 88 88 VAL VAL A . n A 1 110 GLN 110 89 89 GLN GLN A . n A 1 111 ARG 111 90 90 ARG ARG A . n A 1 112 GLU 112 91 91 GLU GLU A . n A 1 113 PRO 113 92 92 PRO PRO A . n A 1 114 VAL 114 93 93 VAL VAL A . n A 1 115 ALA 115 94 94 ALA ALA A . n A 1 116 THR 116 95 95 THR THR A . n A 1 117 ALA 117 96 96 ALA ALA A . n A 1 118 PRO 118 97 97 PRO PRO A . n A 1 119 GLN 119 98 98 GLN GLN A . n A 1 120 PRO 120 99 99 PRO PRO A . n A 1 121 GLY 121 100 100 GLY GLY A . n A 1 122 ALA 122 101 101 ALA ALA A . n A 1 123 GLN 123 102 102 GLN GLN A . n A 1 124 ALA 124 103 103 ALA ALA A . n A 1 125 SER 125 104 104 SER SER A . n A 1 126 ALA 126 105 105 ALA ALA A . n A 1 127 GLN 127 106 106 GLN GLN A . n A 1 128 ARG 128 107 107 ARG ARG A . n A 1 129 GLU 129 108 108 GLU GLU A . n A 1 130 SER 130 109 109 SER SER A . n A 1 131 ILE 131 110 110 ILE ILE A . n A 1 132 GLN 132 111 111 GLN GLN A . n A 1 133 ASP 133 112 112 ASP ASP A . n A 1 134 TYR 134 113 113 TYR TYR A . n A 1 135 LEU 135 114 114 LEU LEU A . n A 1 136 LYS 136 115 115 LYS LYS A . n A 1 137 GLN 137 116 116 GLN GLN A . n A 1 138 SER 138 117 117 SER SER A . n A 1 139 LEU 139 118 118 LEU LEU A . n A 1 140 GLY 140 119 119 GLY GLY A . n A 1 141 GLU 141 120 120 GLU GLU A . n A 1 142 LEU 142 121 121 LEU LEU A . n A 1 143 LEU 143 122 122 LEU LEU A . n A 1 144 PHE 144 123 123 PHE PHE A . n A 1 145 LEU 145 124 124 LEU LEU A . n A 1 146 ASP 146 125 125 ASP ASP A . n A 1 147 PRO 147 126 126 PRO PRO A . n A 1 148 GLY 148 127 127 GLY GLY A . n A 1 149 GLN 149 128 128 GLN GLN A . n A 1 150 LEU 150 129 129 LEU LEU A . n A 1 151 ARG 151 130 130 ARG ARG A . n A 1 152 SER 152 131 131 SER SER A . n A 1 153 GLY 153 132 132 GLY GLY A . n A 1 154 ALA 154 133 133 ALA ALA A . n A 1 155 GLN 155 134 134 GLN GLN A . n A 1 156 PHE 156 135 135 PHE PHE A . n A 1 157 LEU 157 136 136 LEU LEU A . n A 1 158 ASP 158 137 137 ASP ASP A . n A 1 159 LEU 159 138 138 LEU LEU A . n A 1 160 GLY 160 139 139 GLY GLY A . n A 1 161 MET 161 140 140 MET MET A . n A 1 162 ASP 162 141 141 ASP ASP A . n A 1 163 SER 163 142 142 SER SER A . n A 1 164 VAL 164 143 143 VAL VAL A . n A 1 165 THR 165 144 144 THR THR A . n A 1 166 GLY 166 145 145 GLY GLY A . n A 1 167 THR 167 146 146 THR THR A . n A 1 168 GLN 168 147 147 GLN GLN A . n A 1 169 TRP 169 148 148 TRP TRP A . n A 1 170 MET 170 149 149 MET MET A . n A 1 171 ARG 171 150 150 ARG ARG A . n A 1 172 GLY 172 151 151 GLY GLY A . n A 1 173 VAL 173 152 152 VAL VAL A . n A 1 174 SER 174 153 153 SER SER A . n A 1 175 ARG 175 154 154 ARG ARG A . n A 1 176 HIS 176 155 155 HIS HIS A . n A 1 177 PHE 177 156 156 PHE PHE A . n A 1 178 SER 178 157 157 SER SER A . n A 1 179 ILE 179 158 158 ILE ILE A . n A 1 180 GLN 180 159 159 GLN GLN A . n A 1 181 LEU 181 160 160 LEU LEU A . n A 1 182 ALA 182 161 161 ALA ALA A . n A 1 183 ALA 183 162 162 ALA ALA A . n A 1 184 ASP 184 163 163 ASP ASP A . n A 1 185 ALA 185 164 164 ALA ALA A . n A 1 186 ILE 186 165 165 ILE ILE A . n A 1 187 TYR 187 166 166 TYR TYR A . n A 1 188 THR 188 167 167 THR THR A . n A 1 189 TRP 189 168 168 TRP TRP A . n A 1 190 PRO 190 169 169 PRO PRO A . n A 1 191 THR 191 170 170 THR THR A . n A 1 192 LEU 192 171 171 LEU LEU A . n A 1 193 LYS 193 172 172 LYS LYS A . n A 1 194 SER 194 173 173 SER SER A . n A 1 195 LEU 195 174 174 LEU LEU A . n A 1 196 ALA 196 175 175 ALA ALA A . n A 1 197 ASP 197 176 176 ASP ASP A . n A 1 198 GLU 198 177 177 GLU GLU A . n A 1 199 VAL 199 178 178 VAL VAL A . n A 1 200 ASP 200 179 179 ASP ASP A . n A 1 201 ARG 201 180 180 ARG ARG A . n A 1 202 ARG 202 181 181 ARG ARG A . n A 1 203 VAL 203 182 182 VAL VAL A . n A 1 204 GLN 204 183 183 GLN GLN A . n A 1 205 LEU 205 184 ? ? ? A . n A 1 206 GLU 206 185 ? ? ? A . n A 1 207 HIS 207 186 ? ? ? A . n A 1 208 HIS 208 187 ? ? ? A . n A 1 209 HIS 209 188 ? ? ? A . n A 1 210 HIS 210 189 ? ? ? A . n A 1 211 HIS 211 190 ? ? ? A . n A 1 212 HIS 212 191 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-02-15 2 'Structure model' 1 1 2013-09-18 3 'Structure model' 1 2 2013-10-09 4 'Structure model' 1 3 2013-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 20 ? mM ? 1 DTT 5 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HB3 A SER 142 ? ? HH A TYR 166 ? ? 1.29 2 8 HH A TYR 113 ? ? HD1 A HIS 155 ? ? 1.13 3 9 HG A SER 142 ? ? HH A TYR 166 ? ? 1.13 4 10 OE2 A GLU 5 ? ? HG A CYS 6 ? ? 1.58 5 11 HG A SER 142 ? ? HH A TYR 166 ? ? 1.28 6 17 HG A SER 142 ? ? HH A TYR 166 ? ? 1.08 7 17 HG A SER 38 ? ? HH A TYR 62 ? ? 1.32 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CZ A TYR 52 ? ? CE2 A TYR 52 ? ? 1.464 1.381 0.083 0.013 N 2 1 CE1 A PHE 70 ? ? CZ A PHE 70 ? ? 1.546 1.369 0.177 0.019 N 3 1 CZ A PHE 70 ? ? CE2 A PHE 70 ? ? 1.234 1.369 -0.135 0.019 N 4 2 CE1 A TYR 52 ? ? CZ A TYR 52 ? ? 1.264 1.381 -0.117 0.013 N 5 2 CZ A TYR 52 ? ? CE2 A TYR 52 ? ? 1.488 1.381 0.107 0.013 N 6 2 CE1 A TYR 166 ? ? CZ A TYR 166 ? ? 1.291 1.381 -0.090 0.013 N 7 2 CZ A TYR 166 ? ? CE2 A TYR 166 ? ? 1.463 1.381 0.082 0.013 N 8 4 CE1 A TYR 52 ? ? CZ A TYR 52 ? ? 1.291 1.381 -0.090 0.013 N 9 4 CZ A TYR 52 ? ? CE2 A TYR 52 ? ? 1.468 1.381 0.087 0.013 N 10 5 CE1 A TYR 52 ? ? CZ A TYR 52 ? ? 1.242 1.381 -0.139 0.013 N 11 5 CZ A TYR 52 ? ? CE2 A TYR 52 ? ? 1.510 1.381 0.129 0.013 N 12 6 CE1 A TYR 62 ? ? CZ A TYR 62 ? ? 1.289 1.381 -0.092 0.013 N 13 6 CZ A TYR 62 ? ? CE2 A TYR 62 ? ? 1.476 1.381 0.095 0.013 N 14 6 CZ A TYR 64 ? ? CE2 A TYR 64 ? ? 1.303 1.381 -0.078 0.013 N 15 15 CZ A TYR 113 ? ? CE2 A TYR 113 ? ? 1.300 1.381 -0.081 0.013 N 16 16 CE1 A PHE 70 ? ? CZ A PHE 70 ? ? 1.499 1.369 0.130 0.019 N 17 17 CE1 A TYR 52 ? ? CZ A TYR 52 ? ? 1.301 1.381 -0.080 0.013 N 18 17 CE1 A TYR 62 ? ? CZ A TYR 62 ? ? 1.274 1.381 -0.107 0.013 N 19 17 CZ A TYR 62 ? ? CE2 A TYR 62 ? ? 1.488 1.381 0.107 0.013 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? 175.15 -175.31 2 1 GLN A 53 ? ? 63.57 70.72 3 1 ALA A 58 ? ? -63.90 2.18 4 1 PRO A 80 ? ? -81.50 45.38 5 1 THR A 81 ? ? -152.63 47.25 6 1 ALA A 83 ? ? -94.36 -61.62 7 1 ALA A 85 ? ? -146.63 35.77 8 1 ALA A 94 ? ? -106.80 43.64 9 1 PRO A 99 ? ? -96.23 43.18 10 1 PHE A 123 ? ? 85.97 -34.59 11 1 GLN A 128 ? ? -155.87 43.95 12 1 LEU A 129 ? ? 62.15 -178.21 13 1 ALA A 133 ? ? 68.23 128.70 14 2 PRO A 80 ? ? -22.66 -65.82 15 2 VAL A 88 ? ? -107.42 72.82 16 2 VAL A 93 ? ? -84.63 47.13 17 2 SER A 104 ? ? -101.29 55.92 18 2 PHE A 123 ? ? 168.02 -46.01 19 2 ARG A 130 ? ? 73.10 -58.31 20 2 ALA A 133 ? ? -179.66 138.21 21 2 MET A 140 ? ? -109.06 -65.15 22 2 PRO A 169 ? ? -87.12 40.92 23 3 THR A 84 ? ? -86.33 46.58 24 3 PHE A 123 ? ? 73.22 -43.78 25 3 LEU A 129 ? ? 56.85 73.05 26 3 THR A 167 ? ? -147.07 20.75 27 4 GLN A 24 ? ? -141.77 58.42 28 4 ARG A 26 ? ? 73.85 128.05 29 4 PRO A 87 ? ? -65.81 96.93 30 4 PRO A 97 ? ? -77.14 43.14 31 4 SER A 131 ? ? 72.27 -5.22 32 4 PHE A 156 ? ? -98.15 -69.69 33 4 SER A 157 ? ? 171.53 17.32 34 5 GLN A 24 ? ? -94.85 47.15 35 5 LYS A 55 ? ? -97.92 36.34 36 5 PRO A 65 ? ? -83.33 38.05 37 5 GLN A 82 ? ? -97.96 -66.74 38 5 PRO A 97 ? ? -82.35 36.05 39 5 GLN A 128 ? ? -149.84 11.37 40 5 LEU A 129 ? ? 67.48 119.29 41 5 ARG A 130 ? ? -162.33 -72.69 42 5 ALA A 133 ? ? -147.37 59.03 43 6 ALA A 2 ? ? -161.08 -58.46 44 6 ASP A 3 ? ? -101.48 -64.09 45 6 PRO A 80 ? ? -69.13 84.74 46 6 PRO A 87 ? ? -77.35 43.76 47 6 VAL A 88 ? ? -146.91 56.51 48 6 GLN A 89 ? ? 74.66 -59.22 49 6 THR A 95 ? ? 73.77 133.49 50 6 PRO A 99 ? ? -75.20 33.07 51 6 PHE A 123 ? ? 70.45 -29.80 52 6 GLN A 128 ? ? -99.72 33.22 53 6 ALA A 133 ? ? 63.45 90.32 54 6 PHE A 156 ? ? -95.68 -70.31 55 6 SER A 157 ? ? -178.74 -36.08 56 7 LYS A 55 ? ? -69.76 76.06 57 7 ALA A 58 ? ? -66.89 2.33 58 7 THR A 84 ? ? -97.15 35.68 59 7 ARG A 90 ? ? 67.20 94.65 60 7 ALA A 96 ? ? 73.36 96.67 61 7 ARG A 130 ? ? -160.37 -61.15 62 7 MET A 140 ? ? -176.41 92.08 63 8 ALA A 2 ? ? -101.45 -80.29 64 8 PRO A 97 ? ? -67.07 0.83 65 8 SER A 104 ? ? -107.31 43.83 66 8 PHE A 123 ? ? 83.33 -29.73 67 8 ARG A 130 ? ? 71.07 -20.06 68 8 MET A 140 ? ? 62.11 86.95 69 9 LYS A 55 ? ? -116.32 70.52 70 9 THR A 81 ? ? -79.31 49.93 71 9 THR A 84 ? ? 56.12 70.50 72 9 PRO A 92 ? ? -79.84 45.97 73 9 VAL A 93 ? ? 57.39 75.29 74 9 ALA A 96 ? ? -153.56 69.07 75 9 PHE A 123 ? ? 79.96 -48.82 76 9 LEU A 129 ? ? 60.65 -177.48 77 9 THR A 167 ? ? -140.09 14.73 78 10 GLN A 53 ? ? 39.82 55.70 79 10 THR A 81 ? ? -63.16 96.32 80 10 ALA A 85 ? ? 74.58 82.17 81 10 PRO A 87 ? ? -82.19 39.32 82 10 VAL A 88 ? ? 62.30 97.57 83 10 SER A 104 ? ? -106.28 70.01 84 10 LEU A 129 ? ? 63.50 -154.79 85 10 ARG A 130 ? ? 68.13 -78.40 86 11 PRO A 22 ? ? -81.01 49.86 87 11 GLN A 24 ? ? 44.19 29.71 88 11 ARG A 26 ? ? -155.09 -151.16 89 11 LYS A 55 ? ? -114.12 60.74 90 11 ALA A 85 ? ? 59.53 74.80 91 11 PRO A 92 ? ? -76.76 43.58 92 11 SER A 104 ? ? -97.09 32.75 93 11 PHE A 123 ? ? -179.27 -47.84 94 11 GLN A 128 ? ? -140.34 -72.66 95 11 LEU A 129 ? ? 67.79 141.25 96 11 ALA A 133 ? ? 62.07 62.43 97 12 ASP A 3 ? ? -49.96 -74.73 98 12 LYS A 55 ? ? -86.61 46.54 99 12 PRO A 65 ? ? -89.18 36.72 100 12 ALA A 85 ? ? 63.91 70.20 101 12 PRO A 87 ? ? -81.34 48.88 102 12 ALA A 96 ? ? 42.07 83.17 103 12 PRO A 126 ? ? -70.82 32.25 104 12 GLN A 128 ? ? -106.18 40.59 105 12 LEU A 129 ? ? -74.88 48.72 106 12 ARG A 130 ? ? -161.51 -44.15 107 12 ASP A 141 ? ? -137.39 -68.20 108 13 ALA A 2 ? ? 176.26 -177.21 109 13 ILE A 25 ? ? 70.96 140.59 110 13 THR A 95 ? ? 74.77 -48.27 111 13 SER A 104 ? ? -147.54 -32.68 112 13 PRO A 126 ? ? -46.57 107.89 113 13 GLN A 128 ? ? -86.31 42.70 114 14 THR A 63 ? ? -111.04 -73.23 115 14 GLN A 82 ? ? -141.92 -51.75 116 14 ALA A 85 ? ? -111.43 60.49 117 14 ARG A 90 ? ? -67.64 -71.10 118 14 THR A 95 ? ? 166.30 -29.85 119 14 PRO A 97 ? ? -72.66 42.44 120 14 LEU A 122 ? ? -101.13 -76.31 121 14 PHE A 123 ? ? -173.70 -46.05 122 14 PRO A 169 ? ? -94.40 37.22 123 15 VAL A 88 ? ? 66.62 99.40 124 15 VAL A 93 ? ? -87.46 48.29 125 15 SER A 104 ? ? 78.56 92.57 126 15 PHE A 123 ? ? 74.78 -38.89 127 15 LEU A 129 ? ? 63.93 -173.08 128 15 ARG A 130 ? ? 72.56 -49.97 129 16 ASP A 4 ? ? -88.17 31.81 130 16 VAL A 93 ? ? 69.42 79.71 131 16 PRO A 97 ? ? -81.47 36.02 132 16 PRO A 126 ? ? -69.55 0.73 133 16 SER A 131 ? ? 70.91 -48.58 134 16 ALA A 164 ? ? -59.89 -0.61 135 16 TYR A 166 ? ? -94.15 -76.18 136 17 PRO A 65 ? ? -81.09 37.80 137 17 PRO A 87 ? ? -78.46 38.63 138 17 VAL A 88 ? ? -149.50 17.35 139 17 ALA A 103 ? ? -93.36 -61.76 140 17 PRO A 126 ? ? -69.98 6.51 141 17 ALA A 133 ? ? 71.07 114.57 142 18 ALA A 2 ? ? 179.76 -174.00 143 18 PRO A 22 ? ? -81.91 42.93 144 18 PRO A 87 ? ? -61.93 87.55 145 18 ALA A 94 ? ? -100.56 54.86 146 18 PRO A 99 ? ? -69.59 44.79 147 18 SER A 104 ? ? 55.90 99.09 148 18 PHE A 123 ? ? 80.27 -36.36 149 18 PRO A 126 ? ? -91.17 42.81 150 18 ARG A 130 ? ? 79.68 113.96 151 18 TRP A 168 ? ? -165.46 90.24 152 18 PRO A 169 ? ? -81.28 41.90 153 19 ALA A 2 ? ? -142.71 30.73 154 19 ASP A 3 ? ? -91.40 -83.68 155 19 LYS A 55 ? ? -111.83 71.34 156 19 PHE A 123 ? ? 73.92 -35.11 157 19 GLN A 128 ? ? 177.88 24.71 158 19 LEU A 129 ? ? 47.66 -158.19 159 19 ARG A 130 ? ? 76.95 -38.06 160 20 GLN A 82 ? ? -118.11 64.08 161 20 ALA A 83 ? ? -94.08 -61.61 162 20 THR A 84 ? ? -88.19 44.93 163 20 ALA A 85 ? ? -153.52 36.19 164 20 GLN A 89 ? ? -110.85 58.79 165 20 PRO A 92 ? ? -80.63 40.56 166 20 PRO A 99 ? ? -84.59 31.55 167 20 LEU A 122 ? ? -75.29 -81.03 168 20 PHE A 123 ? ? -158.55 -45.14 169 20 GLN A 128 ? ? -89.66 37.10 170 20 SER A 131 ? ? 69.85 -66.34 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 6 TYR A 62 ? ? 0.060 'SIDE CHAIN' 2 9 TYR A 64 ? ? 0.050 'SIDE CHAIN' 3 12 ARG A 180 ? ? 0.076 'SIDE CHAIN' 4 15 TYR A 52 ? ? 0.051 'SIDE CHAIN' 5 20 TYR A 166 ? ? 0.055 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -20 ? A MET 1 2 1 Y 1 A GLY -19 ? A GLY 2 3 1 Y 1 A SER -18 ? A SER 3 4 1 Y 1 A SER -17 ? A SER 4 5 1 Y 1 A HIS -16 ? A HIS 5 6 1 Y 1 A HIS -15 ? A HIS 6 7 1 Y 1 A HIS -14 ? A HIS 7 8 1 Y 1 A HIS -13 ? A HIS 8 9 1 Y 1 A HIS -12 ? A HIS 9 10 1 Y 1 A HIS -11 ? A HIS 10 11 1 Y 1 A SER -10 ? A SER 11 12 1 Y 1 A SER -9 ? A SER 12 13 1 Y 1 A GLY -8 ? A GLY 13 14 1 Y 1 A LEU -7 ? A LEU 14 15 1 Y 1 A VAL -6 ? A VAL 15 16 1 Y 1 A PRO -5 ? A PRO 16 17 1 Y 1 A ARG -4 ? A ARG 17 18 1 Y 1 A GLY -3 ? A GLY 18 19 1 Y 1 A SER -2 ? A SER 19 20 1 Y 1 A HIS -1 ? A HIS 20 21 1 Y 1 A MET 0 ? A MET 21 22 1 Y 1 A LEU 184 ? A LEU 205 23 1 Y 1 A GLU 185 ? A GLU 206 24 1 Y 1 A HIS 186 ? A HIS 207 25 1 Y 1 A HIS 187 ? A HIS 208 26 1 Y 1 A HIS 188 ? A HIS 209 27 1 Y 1 A HIS 189 ? A HIS 210 28 1 Y 1 A HIS 190 ? A HIS 211 29 1 Y 1 A HIS 191 ? A HIS 212 30 2 Y 1 A MET -20 ? A MET 1 31 2 Y 1 A GLY -19 ? A GLY 2 32 2 Y 1 A SER -18 ? A SER 3 33 2 Y 1 A SER -17 ? A SER 4 34 2 Y 1 A HIS -16 ? A HIS 5 35 2 Y 1 A HIS -15 ? A HIS 6 36 2 Y 1 A HIS -14 ? A HIS 7 37 2 Y 1 A HIS -13 ? A HIS 8 38 2 Y 1 A HIS -12 ? A HIS 9 39 2 Y 1 A HIS -11 ? A HIS 10 40 2 Y 1 A SER -10 ? A SER 11 41 2 Y 1 A SER -9 ? A SER 12 42 2 Y 1 A GLY -8 ? A GLY 13 43 2 Y 1 A LEU -7 ? A LEU 14 44 2 Y 1 A VAL -6 ? A VAL 15 45 2 Y 1 A PRO -5 ? A PRO 16 46 2 Y 1 A ARG -4 ? A ARG 17 47 2 Y 1 A GLY -3 ? A GLY 18 48 2 Y 1 A SER -2 ? A SER 19 49 2 Y 1 A HIS -1 ? A HIS 20 50 2 Y 1 A MET 0 ? A MET 21 51 2 Y 1 A LEU 184 ? A LEU 205 52 2 Y 1 A GLU 185 ? A GLU 206 53 2 Y 1 A HIS 186 ? A HIS 207 54 2 Y 1 A HIS 187 ? A HIS 208 55 2 Y 1 A HIS 188 ? A HIS 209 56 2 Y 1 A HIS 189 ? A HIS 210 57 2 Y 1 A HIS 190 ? A HIS 211 58 2 Y 1 A HIS 191 ? A HIS 212 59 3 Y 1 A MET -20 ? A MET 1 60 3 Y 1 A GLY -19 ? A GLY 2 61 3 Y 1 A SER -18 ? A SER 3 62 3 Y 1 A SER -17 ? A SER 4 63 3 Y 1 A HIS -16 ? A HIS 5 64 3 Y 1 A HIS -15 ? A HIS 6 65 3 Y 1 A HIS -14 ? A HIS 7 66 3 Y 1 A HIS -13 ? A HIS 8 67 3 Y 1 A HIS -12 ? A HIS 9 68 3 Y 1 A HIS -11 ? A HIS 10 69 3 Y 1 A SER -10 ? A SER 11 70 3 Y 1 A SER -9 ? A SER 12 71 3 Y 1 A GLY -8 ? A GLY 13 72 3 Y 1 A LEU -7 ? A LEU 14 73 3 Y 1 A VAL -6 ? A VAL 15 74 3 Y 1 A PRO -5 ? A PRO 16 75 3 Y 1 A ARG -4 ? A ARG 17 76 3 Y 1 A GLY -3 ? A GLY 18 77 3 Y 1 A SER -2 ? A SER 19 78 3 Y 1 A HIS -1 ? A HIS 20 79 3 Y 1 A MET 0 ? A MET 21 80 3 Y 1 A LEU 184 ? A LEU 205 81 3 Y 1 A GLU 185 ? A GLU 206 82 3 Y 1 A HIS 186 ? A HIS 207 83 3 Y 1 A HIS 187 ? A HIS 208 84 3 Y 1 A HIS 188 ? A HIS 209 85 3 Y 1 A HIS 189 ? A HIS 210 86 3 Y 1 A HIS 190 ? A HIS 211 87 3 Y 1 A HIS 191 ? A HIS 212 88 4 Y 1 A MET -20 ? A MET 1 89 4 Y 1 A GLY -19 ? A GLY 2 90 4 Y 1 A SER -18 ? A SER 3 91 4 Y 1 A SER -17 ? A SER 4 92 4 Y 1 A HIS -16 ? A HIS 5 93 4 Y 1 A HIS -15 ? A HIS 6 94 4 Y 1 A HIS -14 ? A HIS 7 95 4 Y 1 A HIS -13 ? A HIS 8 96 4 Y 1 A HIS -12 ? A HIS 9 97 4 Y 1 A HIS -11 ? A HIS 10 98 4 Y 1 A SER -10 ? A SER 11 99 4 Y 1 A SER -9 ? A SER 12 100 4 Y 1 A GLY -8 ? A GLY 13 101 4 Y 1 A LEU -7 ? A LEU 14 102 4 Y 1 A VAL -6 ? A VAL 15 103 4 Y 1 A PRO -5 ? A PRO 16 104 4 Y 1 A ARG -4 ? A ARG 17 105 4 Y 1 A GLY -3 ? A GLY 18 106 4 Y 1 A SER -2 ? A SER 19 107 4 Y 1 A HIS -1 ? A HIS 20 108 4 Y 1 A MET 0 ? A MET 21 109 4 Y 1 A LEU 184 ? A LEU 205 110 4 Y 1 A GLU 185 ? A GLU 206 111 4 Y 1 A HIS 186 ? A HIS 207 112 4 Y 1 A HIS 187 ? A HIS 208 113 4 Y 1 A HIS 188 ? A HIS 209 114 4 Y 1 A HIS 189 ? A HIS 210 115 4 Y 1 A HIS 190 ? A HIS 211 116 4 Y 1 A HIS 191 ? A HIS 212 117 5 Y 1 A MET -20 ? A MET 1 118 5 Y 1 A GLY -19 ? A GLY 2 119 5 Y 1 A SER -18 ? A SER 3 120 5 Y 1 A SER -17 ? A SER 4 121 5 Y 1 A HIS -16 ? A HIS 5 122 5 Y 1 A HIS -15 ? A HIS 6 123 5 Y 1 A HIS -14 ? A HIS 7 124 5 Y 1 A HIS -13 ? A HIS 8 125 5 Y 1 A HIS -12 ? A HIS 9 126 5 Y 1 A HIS -11 ? A HIS 10 127 5 Y 1 A SER -10 ? A SER 11 128 5 Y 1 A SER -9 ? A SER 12 129 5 Y 1 A GLY -8 ? A GLY 13 130 5 Y 1 A LEU -7 ? A LEU 14 131 5 Y 1 A VAL -6 ? A VAL 15 132 5 Y 1 A PRO -5 ? A PRO 16 133 5 Y 1 A ARG -4 ? A ARG 17 134 5 Y 1 A GLY -3 ? A GLY 18 135 5 Y 1 A SER -2 ? A SER 19 136 5 Y 1 A HIS -1 ? A HIS 20 137 5 Y 1 A MET 0 ? A MET 21 138 5 Y 1 A LEU 184 ? A LEU 205 139 5 Y 1 A GLU 185 ? A GLU 206 140 5 Y 1 A HIS 186 ? A HIS 207 141 5 Y 1 A HIS 187 ? A HIS 208 142 5 Y 1 A HIS 188 ? A HIS 209 143 5 Y 1 A HIS 189 ? A HIS 210 144 5 Y 1 A HIS 190 ? A HIS 211 145 5 Y 1 A HIS 191 ? A HIS 212 146 6 Y 1 A MET -20 ? A MET 1 147 6 Y 1 A GLY -19 ? A GLY 2 148 6 Y 1 A SER -18 ? A SER 3 149 6 Y 1 A SER -17 ? A SER 4 150 6 Y 1 A HIS -16 ? A HIS 5 151 6 Y 1 A HIS -15 ? A HIS 6 152 6 Y 1 A HIS -14 ? A HIS 7 153 6 Y 1 A HIS -13 ? A HIS 8 154 6 Y 1 A HIS -12 ? A HIS 9 155 6 Y 1 A HIS -11 ? A HIS 10 156 6 Y 1 A SER -10 ? A SER 11 157 6 Y 1 A SER -9 ? A SER 12 158 6 Y 1 A GLY -8 ? A GLY 13 159 6 Y 1 A LEU -7 ? A LEU 14 160 6 Y 1 A VAL -6 ? A VAL 15 161 6 Y 1 A PRO -5 ? A PRO 16 162 6 Y 1 A ARG -4 ? A ARG 17 163 6 Y 1 A GLY -3 ? A GLY 18 164 6 Y 1 A SER -2 ? A SER 19 165 6 Y 1 A HIS -1 ? A HIS 20 166 6 Y 1 A MET 0 ? A MET 21 167 6 Y 1 A LEU 184 ? A LEU 205 168 6 Y 1 A GLU 185 ? A GLU 206 169 6 Y 1 A HIS 186 ? A HIS 207 170 6 Y 1 A HIS 187 ? A HIS 208 171 6 Y 1 A HIS 188 ? A HIS 209 172 6 Y 1 A HIS 189 ? A HIS 210 173 6 Y 1 A HIS 190 ? A HIS 211 174 6 Y 1 A HIS 191 ? A HIS 212 175 7 Y 1 A MET -20 ? A MET 1 176 7 Y 1 A GLY -19 ? A GLY 2 177 7 Y 1 A SER -18 ? A SER 3 178 7 Y 1 A SER -17 ? A SER 4 179 7 Y 1 A HIS -16 ? A HIS 5 180 7 Y 1 A HIS -15 ? A HIS 6 181 7 Y 1 A HIS -14 ? A HIS 7 182 7 Y 1 A HIS -13 ? A HIS 8 183 7 Y 1 A HIS -12 ? A HIS 9 184 7 Y 1 A HIS -11 ? A HIS 10 185 7 Y 1 A SER -10 ? A SER 11 186 7 Y 1 A SER -9 ? A SER 12 187 7 Y 1 A GLY -8 ? A GLY 13 188 7 Y 1 A LEU -7 ? A LEU 14 189 7 Y 1 A VAL -6 ? A VAL 15 190 7 Y 1 A PRO -5 ? A PRO 16 191 7 Y 1 A ARG -4 ? A ARG 17 192 7 Y 1 A GLY -3 ? A GLY 18 193 7 Y 1 A SER -2 ? A SER 19 194 7 Y 1 A HIS -1 ? A HIS 20 195 7 Y 1 A MET 0 ? A MET 21 196 7 Y 1 A LEU 184 ? A LEU 205 197 7 Y 1 A GLU 185 ? A GLU 206 198 7 Y 1 A HIS 186 ? A HIS 207 199 7 Y 1 A HIS 187 ? A HIS 208 200 7 Y 1 A HIS 188 ? A HIS 209 201 7 Y 1 A HIS 189 ? A HIS 210 202 7 Y 1 A HIS 190 ? A HIS 211 203 7 Y 1 A HIS 191 ? A HIS 212 204 8 Y 1 A MET -20 ? A MET 1 205 8 Y 1 A GLY -19 ? A GLY 2 206 8 Y 1 A SER -18 ? A SER 3 207 8 Y 1 A SER -17 ? A SER 4 208 8 Y 1 A HIS -16 ? A HIS 5 209 8 Y 1 A HIS -15 ? A HIS 6 210 8 Y 1 A HIS -14 ? A HIS 7 211 8 Y 1 A HIS -13 ? A HIS 8 212 8 Y 1 A HIS -12 ? A HIS 9 213 8 Y 1 A HIS -11 ? A HIS 10 214 8 Y 1 A SER -10 ? A SER 11 215 8 Y 1 A SER -9 ? A SER 12 216 8 Y 1 A GLY -8 ? A GLY 13 217 8 Y 1 A LEU -7 ? A LEU 14 218 8 Y 1 A VAL -6 ? A VAL 15 219 8 Y 1 A PRO -5 ? A PRO 16 220 8 Y 1 A ARG -4 ? A ARG 17 221 8 Y 1 A GLY -3 ? A GLY 18 222 8 Y 1 A SER -2 ? A SER 19 223 8 Y 1 A HIS -1 ? A HIS 20 224 8 Y 1 A MET 0 ? A MET 21 225 8 Y 1 A LEU 184 ? A LEU 205 226 8 Y 1 A GLU 185 ? A GLU 206 227 8 Y 1 A HIS 186 ? A HIS 207 228 8 Y 1 A HIS 187 ? A HIS 208 229 8 Y 1 A HIS 188 ? A HIS 209 230 8 Y 1 A HIS 189 ? A HIS 210 231 8 Y 1 A HIS 190 ? A HIS 211 232 8 Y 1 A HIS 191 ? A HIS 212 233 9 Y 1 A MET -20 ? A MET 1 234 9 Y 1 A GLY -19 ? A GLY 2 235 9 Y 1 A SER -18 ? A SER 3 236 9 Y 1 A SER -17 ? A SER 4 237 9 Y 1 A HIS -16 ? A HIS 5 238 9 Y 1 A HIS -15 ? A HIS 6 239 9 Y 1 A HIS -14 ? A HIS 7 240 9 Y 1 A HIS -13 ? A HIS 8 241 9 Y 1 A HIS -12 ? A HIS 9 242 9 Y 1 A HIS -11 ? A HIS 10 243 9 Y 1 A SER -10 ? A SER 11 244 9 Y 1 A SER -9 ? A SER 12 245 9 Y 1 A GLY -8 ? A GLY 13 246 9 Y 1 A LEU -7 ? A LEU 14 247 9 Y 1 A VAL -6 ? A VAL 15 248 9 Y 1 A PRO -5 ? A PRO 16 249 9 Y 1 A ARG -4 ? A ARG 17 250 9 Y 1 A GLY -3 ? A GLY 18 251 9 Y 1 A SER -2 ? A SER 19 252 9 Y 1 A HIS -1 ? A HIS 20 253 9 Y 1 A MET 0 ? A MET 21 254 9 Y 1 A LEU 184 ? A LEU 205 255 9 Y 1 A GLU 185 ? A GLU 206 256 9 Y 1 A HIS 186 ? A HIS 207 257 9 Y 1 A HIS 187 ? A HIS 208 258 9 Y 1 A HIS 188 ? A HIS 209 259 9 Y 1 A HIS 189 ? A HIS 210 260 9 Y 1 A HIS 190 ? A HIS 211 261 9 Y 1 A HIS 191 ? A HIS 212 262 10 Y 1 A MET -20 ? A MET 1 263 10 Y 1 A GLY -19 ? A GLY 2 264 10 Y 1 A SER -18 ? A SER 3 265 10 Y 1 A SER -17 ? A SER 4 266 10 Y 1 A HIS -16 ? A HIS 5 267 10 Y 1 A HIS -15 ? A HIS 6 268 10 Y 1 A HIS -14 ? A HIS 7 269 10 Y 1 A HIS -13 ? A HIS 8 270 10 Y 1 A HIS -12 ? A HIS 9 271 10 Y 1 A HIS -11 ? A HIS 10 272 10 Y 1 A SER -10 ? A SER 11 273 10 Y 1 A SER -9 ? A SER 12 274 10 Y 1 A GLY -8 ? A GLY 13 275 10 Y 1 A LEU -7 ? A LEU 14 276 10 Y 1 A VAL -6 ? A VAL 15 277 10 Y 1 A PRO -5 ? A PRO 16 278 10 Y 1 A ARG -4 ? A ARG 17 279 10 Y 1 A GLY -3 ? A GLY 18 280 10 Y 1 A SER -2 ? A SER 19 281 10 Y 1 A HIS -1 ? A HIS 20 282 10 Y 1 A MET 0 ? A MET 21 283 10 Y 1 A LEU 184 ? A LEU 205 284 10 Y 1 A GLU 185 ? A GLU 206 285 10 Y 1 A HIS 186 ? A HIS 207 286 10 Y 1 A HIS 187 ? A HIS 208 287 10 Y 1 A HIS 188 ? A HIS 209 288 10 Y 1 A HIS 189 ? A HIS 210 289 10 Y 1 A HIS 190 ? A HIS 211 290 10 Y 1 A HIS 191 ? A HIS 212 291 11 Y 1 A MET -20 ? A MET 1 292 11 Y 1 A GLY -19 ? A GLY 2 293 11 Y 1 A SER -18 ? A SER 3 294 11 Y 1 A SER -17 ? A SER 4 295 11 Y 1 A HIS -16 ? A HIS 5 296 11 Y 1 A HIS -15 ? A HIS 6 297 11 Y 1 A HIS -14 ? A HIS 7 298 11 Y 1 A HIS -13 ? A HIS 8 299 11 Y 1 A HIS -12 ? A HIS 9 300 11 Y 1 A HIS -11 ? A HIS 10 301 11 Y 1 A SER -10 ? A SER 11 302 11 Y 1 A SER -9 ? A SER 12 303 11 Y 1 A GLY -8 ? A GLY 13 304 11 Y 1 A LEU -7 ? A LEU 14 305 11 Y 1 A VAL -6 ? A VAL 15 306 11 Y 1 A PRO -5 ? A PRO 16 307 11 Y 1 A ARG -4 ? A ARG 17 308 11 Y 1 A GLY -3 ? A GLY 18 309 11 Y 1 A SER -2 ? A SER 19 310 11 Y 1 A HIS -1 ? A HIS 20 311 11 Y 1 A MET 0 ? A MET 21 312 11 Y 1 A LEU 184 ? A LEU 205 313 11 Y 1 A GLU 185 ? A GLU 206 314 11 Y 1 A HIS 186 ? A HIS 207 315 11 Y 1 A HIS 187 ? A HIS 208 316 11 Y 1 A HIS 188 ? A HIS 209 317 11 Y 1 A HIS 189 ? A HIS 210 318 11 Y 1 A HIS 190 ? A HIS 211 319 11 Y 1 A HIS 191 ? A HIS 212 320 12 Y 1 A MET -20 ? A MET 1 321 12 Y 1 A GLY -19 ? A GLY 2 322 12 Y 1 A SER -18 ? A SER 3 323 12 Y 1 A SER -17 ? A SER 4 324 12 Y 1 A HIS -16 ? A HIS 5 325 12 Y 1 A HIS -15 ? A HIS 6 326 12 Y 1 A HIS -14 ? A HIS 7 327 12 Y 1 A HIS -13 ? A HIS 8 328 12 Y 1 A HIS -12 ? A HIS 9 329 12 Y 1 A HIS -11 ? A HIS 10 330 12 Y 1 A SER -10 ? A SER 11 331 12 Y 1 A SER -9 ? A SER 12 332 12 Y 1 A GLY -8 ? A GLY 13 333 12 Y 1 A LEU -7 ? A LEU 14 334 12 Y 1 A VAL -6 ? A VAL 15 335 12 Y 1 A PRO -5 ? A PRO 16 336 12 Y 1 A ARG -4 ? A ARG 17 337 12 Y 1 A GLY -3 ? A GLY 18 338 12 Y 1 A SER -2 ? A SER 19 339 12 Y 1 A HIS -1 ? A HIS 20 340 12 Y 1 A MET 0 ? A MET 21 341 12 Y 1 A LEU 184 ? A LEU 205 342 12 Y 1 A GLU 185 ? A GLU 206 343 12 Y 1 A HIS 186 ? A HIS 207 344 12 Y 1 A HIS 187 ? A HIS 208 345 12 Y 1 A HIS 188 ? A HIS 209 346 12 Y 1 A HIS 189 ? A HIS 210 347 12 Y 1 A HIS 190 ? A HIS 211 348 12 Y 1 A HIS 191 ? A HIS 212 349 13 Y 1 A MET -20 ? A MET 1 350 13 Y 1 A GLY -19 ? A GLY 2 351 13 Y 1 A SER -18 ? A SER 3 352 13 Y 1 A SER -17 ? A SER 4 353 13 Y 1 A HIS -16 ? A HIS 5 354 13 Y 1 A HIS -15 ? A HIS 6 355 13 Y 1 A HIS -14 ? A HIS 7 356 13 Y 1 A HIS -13 ? A HIS 8 357 13 Y 1 A HIS -12 ? A HIS 9 358 13 Y 1 A HIS -11 ? A HIS 10 359 13 Y 1 A SER -10 ? A SER 11 360 13 Y 1 A SER -9 ? A SER 12 361 13 Y 1 A GLY -8 ? A GLY 13 362 13 Y 1 A LEU -7 ? A LEU 14 363 13 Y 1 A VAL -6 ? A VAL 15 364 13 Y 1 A PRO -5 ? A PRO 16 365 13 Y 1 A ARG -4 ? A ARG 17 366 13 Y 1 A GLY -3 ? A GLY 18 367 13 Y 1 A SER -2 ? A SER 19 368 13 Y 1 A HIS -1 ? A HIS 20 369 13 Y 1 A MET 0 ? A MET 21 370 13 Y 1 A LEU 184 ? A LEU 205 371 13 Y 1 A GLU 185 ? A GLU 206 372 13 Y 1 A HIS 186 ? A HIS 207 373 13 Y 1 A HIS 187 ? A HIS 208 374 13 Y 1 A HIS 188 ? A HIS 209 375 13 Y 1 A HIS 189 ? A HIS 210 376 13 Y 1 A HIS 190 ? A HIS 211 377 13 Y 1 A HIS 191 ? A HIS 212 378 14 Y 1 A MET -20 ? A MET 1 379 14 Y 1 A GLY -19 ? A GLY 2 380 14 Y 1 A SER -18 ? A SER 3 381 14 Y 1 A SER -17 ? A SER 4 382 14 Y 1 A HIS -16 ? A HIS 5 383 14 Y 1 A HIS -15 ? A HIS 6 384 14 Y 1 A HIS -14 ? A HIS 7 385 14 Y 1 A HIS -13 ? A HIS 8 386 14 Y 1 A HIS -12 ? A HIS 9 387 14 Y 1 A HIS -11 ? A HIS 10 388 14 Y 1 A SER -10 ? A SER 11 389 14 Y 1 A SER -9 ? A SER 12 390 14 Y 1 A GLY -8 ? A GLY 13 391 14 Y 1 A LEU -7 ? A LEU 14 392 14 Y 1 A VAL -6 ? A VAL 15 393 14 Y 1 A PRO -5 ? A PRO 16 394 14 Y 1 A ARG -4 ? A ARG 17 395 14 Y 1 A GLY -3 ? A GLY 18 396 14 Y 1 A SER -2 ? A SER 19 397 14 Y 1 A HIS -1 ? A HIS 20 398 14 Y 1 A MET 0 ? A MET 21 399 14 Y 1 A LEU 184 ? A LEU 205 400 14 Y 1 A GLU 185 ? A GLU 206 401 14 Y 1 A HIS 186 ? A HIS 207 402 14 Y 1 A HIS 187 ? A HIS 208 403 14 Y 1 A HIS 188 ? A HIS 209 404 14 Y 1 A HIS 189 ? A HIS 210 405 14 Y 1 A HIS 190 ? A HIS 211 406 14 Y 1 A HIS 191 ? A HIS 212 407 15 Y 1 A MET -20 ? A MET 1 408 15 Y 1 A GLY -19 ? A GLY 2 409 15 Y 1 A SER -18 ? A SER 3 410 15 Y 1 A SER -17 ? A SER 4 411 15 Y 1 A HIS -16 ? A HIS 5 412 15 Y 1 A HIS -15 ? A HIS 6 413 15 Y 1 A HIS -14 ? A HIS 7 414 15 Y 1 A HIS -13 ? A HIS 8 415 15 Y 1 A HIS -12 ? A HIS 9 416 15 Y 1 A HIS -11 ? A HIS 10 417 15 Y 1 A SER -10 ? A SER 11 418 15 Y 1 A SER -9 ? A SER 12 419 15 Y 1 A GLY -8 ? A GLY 13 420 15 Y 1 A LEU -7 ? A LEU 14 421 15 Y 1 A VAL -6 ? A VAL 15 422 15 Y 1 A PRO -5 ? A PRO 16 423 15 Y 1 A ARG -4 ? A ARG 17 424 15 Y 1 A GLY -3 ? A GLY 18 425 15 Y 1 A SER -2 ? A SER 19 426 15 Y 1 A HIS -1 ? A HIS 20 427 15 Y 1 A MET 0 ? A MET 21 428 15 Y 1 A LEU 184 ? A LEU 205 429 15 Y 1 A GLU 185 ? A GLU 206 430 15 Y 1 A HIS 186 ? A HIS 207 431 15 Y 1 A HIS 187 ? A HIS 208 432 15 Y 1 A HIS 188 ? A HIS 209 433 15 Y 1 A HIS 189 ? A HIS 210 434 15 Y 1 A HIS 190 ? A HIS 211 435 15 Y 1 A HIS 191 ? A HIS 212 436 16 Y 1 A MET -20 ? A MET 1 437 16 Y 1 A GLY -19 ? A GLY 2 438 16 Y 1 A SER -18 ? A SER 3 439 16 Y 1 A SER -17 ? A SER 4 440 16 Y 1 A HIS -16 ? A HIS 5 441 16 Y 1 A HIS -15 ? A HIS 6 442 16 Y 1 A HIS -14 ? A HIS 7 443 16 Y 1 A HIS -13 ? A HIS 8 444 16 Y 1 A HIS -12 ? A HIS 9 445 16 Y 1 A HIS -11 ? A HIS 10 446 16 Y 1 A SER -10 ? A SER 11 447 16 Y 1 A SER -9 ? A SER 12 448 16 Y 1 A GLY -8 ? A GLY 13 449 16 Y 1 A LEU -7 ? A LEU 14 450 16 Y 1 A VAL -6 ? A VAL 15 451 16 Y 1 A PRO -5 ? A PRO 16 452 16 Y 1 A ARG -4 ? A ARG 17 453 16 Y 1 A GLY -3 ? A GLY 18 454 16 Y 1 A SER -2 ? A SER 19 455 16 Y 1 A HIS -1 ? A HIS 20 456 16 Y 1 A MET 0 ? A MET 21 457 16 Y 1 A LEU 184 ? A LEU 205 458 16 Y 1 A GLU 185 ? A GLU 206 459 16 Y 1 A HIS 186 ? A HIS 207 460 16 Y 1 A HIS 187 ? A HIS 208 461 16 Y 1 A HIS 188 ? A HIS 209 462 16 Y 1 A HIS 189 ? A HIS 210 463 16 Y 1 A HIS 190 ? A HIS 211 464 16 Y 1 A HIS 191 ? A HIS 212 465 17 Y 1 A MET -20 ? A MET 1 466 17 Y 1 A GLY -19 ? A GLY 2 467 17 Y 1 A SER -18 ? A SER 3 468 17 Y 1 A SER -17 ? A SER 4 469 17 Y 1 A HIS -16 ? A HIS 5 470 17 Y 1 A HIS -15 ? A HIS 6 471 17 Y 1 A HIS -14 ? A HIS 7 472 17 Y 1 A HIS -13 ? A HIS 8 473 17 Y 1 A HIS -12 ? A HIS 9 474 17 Y 1 A HIS -11 ? A HIS 10 475 17 Y 1 A SER -10 ? A SER 11 476 17 Y 1 A SER -9 ? A SER 12 477 17 Y 1 A GLY -8 ? A GLY 13 478 17 Y 1 A LEU -7 ? A LEU 14 479 17 Y 1 A VAL -6 ? A VAL 15 480 17 Y 1 A PRO -5 ? A PRO 16 481 17 Y 1 A ARG -4 ? A ARG 17 482 17 Y 1 A GLY -3 ? A GLY 18 483 17 Y 1 A SER -2 ? A SER 19 484 17 Y 1 A HIS -1 ? A HIS 20 485 17 Y 1 A MET 0 ? A MET 21 486 17 Y 1 A LEU 184 ? A LEU 205 487 17 Y 1 A GLU 185 ? A GLU 206 488 17 Y 1 A HIS 186 ? A HIS 207 489 17 Y 1 A HIS 187 ? A HIS 208 490 17 Y 1 A HIS 188 ? A HIS 209 491 17 Y 1 A HIS 189 ? A HIS 210 492 17 Y 1 A HIS 190 ? A HIS 211 493 17 Y 1 A HIS 191 ? A HIS 212 494 18 Y 1 A MET -20 ? A MET 1 495 18 Y 1 A GLY -19 ? A GLY 2 496 18 Y 1 A SER -18 ? A SER 3 497 18 Y 1 A SER -17 ? A SER 4 498 18 Y 1 A HIS -16 ? A HIS 5 499 18 Y 1 A HIS -15 ? A HIS 6 500 18 Y 1 A HIS -14 ? A HIS 7 501 18 Y 1 A HIS -13 ? A HIS 8 502 18 Y 1 A HIS -12 ? A HIS 9 503 18 Y 1 A HIS -11 ? A HIS 10 504 18 Y 1 A SER -10 ? A SER 11 505 18 Y 1 A SER -9 ? A SER 12 506 18 Y 1 A GLY -8 ? A GLY 13 507 18 Y 1 A LEU -7 ? A LEU 14 508 18 Y 1 A VAL -6 ? A VAL 15 509 18 Y 1 A PRO -5 ? A PRO 16 510 18 Y 1 A ARG -4 ? A ARG 17 511 18 Y 1 A GLY -3 ? A GLY 18 512 18 Y 1 A SER -2 ? A SER 19 513 18 Y 1 A HIS -1 ? A HIS 20 514 18 Y 1 A MET 0 ? A MET 21 515 18 Y 1 A LEU 184 ? A LEU 205 516 18 Y 1 A GLU 185 ? A GLU 206 517 18 Y 1 A HIS 186 ? A HIS 207 518 18 Y 1 A HIS 187 ? A HIS 208 519 18 Y 1 A HIS 188 ? A HIS 209 520 18 Y 1 A HIS 189 ? A HIS 210 521 18 Y 1 A HIS 190 ? A HIS 211 522 18 Y 1 A HIS 191 ? A HIS 212 523 19 Y 1 A MET -20 ? A MET 1 524 19 Y 1 A GLY -19 ? A GLY 2 525 19 Y 1 A SER -18 ? A SER 3 526 19 Y 1 A SER -17 ? A SER 4 527 19 Y 1 A HIS -16 ? A HIS 5 528 19 Y 1 A HIS -15 ? A HIS 6 529 19 Y 1 A HIS -14 ? A HIS 7 530 19 Y 1 A HIS -13 ? A HIS 8 531 19 Y 1 A HIS -12 ? A HIS 9 532 19 Y 1 A HIS -11 ? A HIS 10 533 19 Y 1 A SER -10 ? A SER 11 534 19 Y 1 A SER -9 ? A SER 12 535 19 Y 1 A GLY -8 ? A GLY 13 536 19 Y 1 A LEU -7 ? A LEU 14 537 19 Y 1 A VAL -6 ? A VAL 15 538 19 Y 1 A PRO -5 ? A PRO 16 539 19 Y 1 A ARG -4 ? A ARG 17 540 19 Y 1 A GLY -3 ? A GLY 18 541 19 Y 1 A SER -2 ? A SER 19 542 19 Y 1 A HIS -1 ? A HIS 20 543 19 Y 1 A MET 0 ? A MET 21 544 19 Y 1 A LEU 184 ? A LEU 205 545 19 Y 1 A GLU 185 ? A GLU 206 546 19 Y 1 A HIS 186 ? A HIS 207 547 19 Y 1 A HIS 187 ? A HIS 208 548 19 Y 1 A HIS 188 ? A HIS 209 549 19 Y 1 A HIS 189 ? A HIS 210 550 19 Y 1 A HIS 190 ? A HIS 211 551 19 Y 1 A HIS 191 ? A HIS 212 552 20 Y 1 A MET -20 ? A MET 1 553 20 Y 1 A GLY -19 ? A GLY 2 554 20 Y 1 A SER -18 ? A SER 3 555 20 Y 1 A SER -17 ? A SER 4 556 20 Y 1 A HIS -16 ? A HIS 5 557 20 Y 1 A HIS -15 ? A HIS 6 558 20 Y 1 A HIS -14 ? A HIS 7 559 20 Y 1 A HIS -13 ? A HIS 8 560 20 Y 1 A HIS -12 ? A HIS 9 561 20 Y 1 A HIS -11 ? A HIS 10 562 20 Y 1 A SER -10 ? A SER 11 563 20 Y 1 A SER -9 ? A SER 12 564 20 Y 1 A GLY -8 ? A GLY 13 565 20 Y 1 A LEU -7 ? A LEU 14 566 20 Y 1 A VAL -6 ? A VAL 15 567 20 Y 1 A PRO -5 ? A PRO 16 568 20 Y 1 A ARG -4 ? A ARG 17 569 20 Y 1 A GLY -3 ? A GLY 18 570 20 Y 1 A SER -2 ? A SER 19 571 20 Y 1 A HIS -1 ? A HIS 20 572 20 Y 1 A MET 0 ? A MET 21 573 20 Y 1 A LEU 184 ? A LEU 205 574 20 Y 1 A GLU 185 ? A GLU 206 575 20 Y 1 A HIS 186 ? A HIS 207 576 20 Y 1 A HIS 187 ? A HIS 208 577 20 Y 1 A HIS 188 ? A HIS 209 578 20 Y 1 A HIS 189 ? A HIS 210 579 20 Y 1 A HIS 190 ? A HIS 211 580 20 Y 1 A HIS 191 ? A HIS 212 #