data_2L2E # _entry.id 2L2E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L2E RCSB RCSB101870 WWPDB D_1000101870 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L2E _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-08-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ames, J.' 1 'Lim, S.' 2 # _citation.id primary _citation.title '1H, 15N, 13C chemical shift assignments for neuronal calcium sensor-1 from fission yeast (Ncs1p)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Ames, J.' _citation_author.ordinal 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Calcium-binding protein NCS-1' _entity.formula_weight 22138.170 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MYR)GKSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLNKSEFQKIYKQFFPFGDPSAFAEYVFNVFDADK NGYIDFKEFICALSVTSRGELNDKLIWAFQLYDLDNNGLISYDEMLRIVDAIYKMVGSMVKLPEDEDTPEKRVNKIFNMM DKNKDGQLTLEEFCEGSKRDPTIVSALSLYDGLV ; _entity_poly.pdbx_seq_one_letter_code_can ;XGKSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLNKSEFQKIYKQFFPFGDPSAFAEYVFNVFDADKNGYI DFKEFICALSVTSRGELNDKLIWAFQLYDLDNNGLISYDEMLRIVDAIYKMVGSMVKLPEDEDTPEKRVNKIFNMMDKNK DGQLTLEEFCEGSKRDPTIVSALSLYDGLV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MYR n 1 2 GLY n 1 3 LYS n 1 4 SER n 1 5 GLN n 1 6 SER n 1 7 LYS n 1 8 LEU n 1 9 SER n 1 10 GLN n 1 11 ASP n 1 12 GLN n 1 13 LEU n 1 14 GLN n 1 15 ASP n 1 16 LEU n 1 17 VAL n 1 18 ARG n 1 19 SER n 1 20 THR n 1 21 ARG n 1 22 PHE n 1 23 ASP n 1 24 LYS n 1 25 LYS n 1 26 GLU n 1 27 LEU n 1 28 GLN n 1 29 GLN n 1 30 TRP n 1 31 TYR n 1 32 LYS n 1 33 GLY n 1 34 PHE n 1 35 PHE n 1 36 LYS n 1 37 ASP n 1 38 CYS n 1 39 PRO n 1 40 SER n 1 41 GLY n 1 42 HIS n 1 43 LEU n 1 44 ASN n 1 45 LYS n 1 46 SER n 1 47 GLU n 1 48 PHE n 1 49 GLN n 1 50 LYS n 1 51 ILE n 1 52 TYR n 1 53 LYS n 1 54 GLN n 1 55 PHE n 1 56 PHE n 1 57 PRO n 1 58 PHE n 1 59 GLY n 1 60 ASP n 1 61 PRO n 1 62 SER n 1 63 ALA n 1 64 PHE n 1 65 ALA n 1 66 GLU n 1 67 TYR n 1 68 VAL n 1 69 PHE n 1 70 ASN n 1 71 VAL n 1 72 PHE n 1 73 ASP n 1 74 ALA n 1 75 ASP n 1 76 LYS n 1 77 ASN n 1 78 GLY n 1 79 TYR n 1 80 ILE n 1 81 ASP n 1 82 PHE n 1 83 LYS n 1 84 GLU n 1 85 PHE n 1 86 ILE n 1 87 CYS n 1 88 ALA n 1 89 LEU n 1 90 SER n 1 91 VAL n 1 92 THR n 1 93 SER n 1 94 ARG n 1 95 GLY n 1 96 GLU n 1 97 LEU n 1 98 ASN n 1 99 ASP n 1 100 LYS n 1 101 LEU n 1 102 ILE n 1 103 TRP n 1 104 ALA n 1 105 PHE n 1 106 GLN n 1 107 LEU n 1 108 TYR n 1 109 ASP n 1 110 LEU n 1 111 ASP n 1 112 ASN n 1 113 ASN n 1 114 GLY n 1 115 LEU n 1 116 ILE n 1 117 SER n 1 118 TYR n 1 119 ASP n 1 120 GLU n 1 121 MET n 1 122 LEU n 1 123 ARG n 1 124 ILE n 1 125 VAL n 1 126 ASP n 1 127 ALA n 1 128 ILE n 1 129 TYR n 1 130 LYS n 1 131 MET n 1 132 VAL n 1 133 GLY n 1 134 SER n 1 135 MET n 1 136 VAL n 1 137 LYS n 1 138 LEU n 1 139 PRO n 1 140 GLU n 1 141 ASP n 1 142 GLU n 1 143 ASP n 1 144 THR n 1 145 PRO n 1 146 GLU n 1 147 LYS n 1 148 ARG n 1 149 VAL n 1 150 ASN n 1 151 LYS n 1 152 ILE n 1 153 PHE n 1 154 ASN n 1 155 MET n 1 156 MET n 1 157 ASP n 1 158 LYS n 1 159 ASN n 1 160 LYS n 1 161 ASP n 1 162 GLY n 1 163 GLN n 1 164 LEU n 1 165 THR n 1 166 LEU n 1 167 GLU n 1 168 GLU n 1 169 PHE n 1 170 CYS n 1 171 GLU n 1 172 GLY n 1 173 SER n 1 174 LYS n 1 175 ARG n 1 176 ASP n 1 177 PRO n 1 178 THR n 1 179 ILE n 1 180 VAL n 1 181 SER n 1 182 ALA n 1 183 LEU n 1 184 SER n 1 185 LEU n 1 186 TYR n 1 187 ASP n 1 188 GLY n 1 189 LEU n 1 190 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Fission yeast' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ncs1, SPAC18B11.04' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4896 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET11a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCS1_SCHPO _struct_ref.pdbx_db_accession Q09711 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GKSQSKLSQDQLQDLVRSTRFDKKELQQWYKGFFKDCPSGHLNKSEFQKIYKQFFPFGDPSAFAEYVFNVFDADKNGYID FKEFICALSVTSRGELNDKLIWAFQLYDLDNNGLISYDEMLRIVDAIYKMVGSMVKLPEDEDTPEKRVNKIFNMMDKNKD GQLTLEEFCEGSKRDPTIVSALSLYDGLV ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L2E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 190 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q09711 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 190 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 190 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2L2E _struct_ref_seq_dif.mon_id MYR _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q09711 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details INSERTION _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MYR non-polymer . 'MYRISTIC ACID' ? 'C14 H28 O2' 228.371 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCACB' 1 4 1 '3D HBHA(CO)NH' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HCCH-TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.02 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.7 mM [U-95% 13C; U-95% 15N] Ncs1p, 0.7 mM [U-98% 15N] Ncs1p, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 800 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L2E _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L2E _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L2E _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 2 'Schwieters, Kuszewski, Tjandra and Clore' refinement X-PLOR_NIH ? 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L2E _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L2E _struct.title 'Solution NMR structure of myristoylated NCS1p in apo form' _struct.pdbx_descriptor 'Calcium-binding protein NCS-1' _struct.pdbx_model_details 'closest to the average, model 2' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L2E _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'NCS1p, myristoylated, METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? ARG A 21 ? SER A 9 ARG A 21 1 ? 13 HELX_P HELX_P2 2 LYS A 24 ? CYS A 38 ? LYS A 24 CYS A 38 1 ? 15 HELX_P HELX_P3 3 ASN A 44 ? PHE A 56 ? ASN A 44 PHE A 56 1 ? 13 HELX_P HELX_P4 4 ASP A 60 ? ASP A 73 ? ASP A 60 ASP A 73 1 ? 14 HELX_P HELX_P5 5 PHE A 82 ? SER A 90 ? PHE A 82 SER A 90 1 ? 9 HELX_P HELX_P6 6 LEU A 97 ? ASP A 109 ? LEU A 97 ASP A 109 1 ? 13 HELX_P HELX_P7 7 SER A 117 ? VAL A 136 ? SER A 117 VAL A 136 1 ? 20 HELX_P HELX_P8 8 PRO A 145 ? ASP A 157 ? PRO A 145 ASP A 157 1 ? 13 HELX_P HELX_P9 9 THR A 165 ? ARG A 175 ? THR A 165 ARG A 175 1 ? 11 HELX_P HELX_P10 10 PRO A 177 ? LEU A 185 ? PRO A 177 LEU A 185 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id MYR _struct_conn.ptnr1_label_seq_id 1 _struct_conn.ptnr1_label_atom_id C1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id GLY _struct_conn.ptnr2_label_seq_id 2 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id MYR _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id GLY _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.307 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 42 ? LEU A 43 ? HIS A 42 LEU A 43 A 2 ILE A 80 ? ASP A 81 ? ILE A 80 ASP A 81 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 43 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 43 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 80 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 80 # _atom_sites.entry_id 2L2E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MYR 1 1 1 MYR MYR A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASN 44 44 44 ASN ASN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 PHE 105 105 105 PHE PHE A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 ASP 119 119 119 ASP ASP A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 LYS 130 130 130 LYS LYS A . n A 1 131 MET 131 131 131 MET MET A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 MET 135 135 135 MET MET A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 PRO 139 139 139 PRO PRO A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 MET 155 155 155 MET MET A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 PHE 169 169 169 PHE PHE A . n A 1 170 CYS 170 170 170 CYS CYS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 PRO 177 177 177 PRO PRO A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 ASP 187 187 187 ASP ASP A . n A 1 188 GLY 188 188 188 GLY GLY A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 VAL 190 190 190 VAL VAL A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-02-02 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Ncs1p-1 0.7 ? mM '[U-95% 13C; U-95% 15N]' 1 Ncs1p-2 0.7 ? mM '[U-98% 15N]' 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 165 ? ? H A PHE 169 ? ? 1.56 2 1 O A VAL 68 ? ? H A PHE 72 ? ? 1.59 3 2 O A LEU 27 ? ? H A TYR 31 ? ? 1.56 4 2 HZ3 A LYS 158 ? ? OE1 A GLU 168 ? ? 1.57 5 2 O A LYS 151 ? ? H A MET 155 ? ? 1.58 6 2 O A VAL 68 ? ? H A PHE 72 ? ? 1.59 7 2 O A GLY 95 ? ? HZ3 A LYS 100 ? ? 1.59 8 3 OD1 A ASN 44 ? ? H A SER 46 ? ? 1.55 9 3 O A VAL 68 ? ? H A PHE 72 ? ? 1.56 10 3 O A PRO 139 ? ? H A ASP 141 ? ? 1.56 11 3 O A SER 173 ? ? H A ASP 176 ? ? 1.57 12 3 O A LEU 27 ? ? H A TYR 31 ? ? 1.57 13 3 O A ILE 102 ? ? H A GLN 106 ? ? 1.58 14 3 O A LYS 151 ? ? H A MET 155 ? ? 1.58 15 3 O A ASN 150 ? ? H A ASN 154 ? ? 1.59 16 4 HG A SER 46 ? ? H A GLU 47 ? ? 1.32 17 4 O A ASP 99 ? ? H A TRP 103 ? ? 1.54 18 4 O A LYS 151 ? ? H A MET 155 ? ? 1.54 19 4 O A VAL 68 ? ? H A PHE 72 ? ? 1.54 20 4 O A ASN 150 ? ? H A ASN 154 ? ? 1.57 21 4 O A THR 165 ? ? H A PHE 169 ? ? 1.57 22 4 O A LEU 27 ? ? H A TYR 31 ? ? 1.58 23 4 O A ILE 102 ? ? H A GLN 106 ? ? 1.59 24 5 O A PRO 139 ? ? H A ASP 141 ? ? 1.55 25 5 O A VAL 68 ? ? H A PHE 72 ? ? 1.55 26 5 O A ILE 102 ? ? H A GLN 106 ? ? 1.56 27 5 O A GLU 96 ? ? H A ASN 98 ? ? 1.57 28 5 O A LEU 27 ? ? H A TYR 31 ? ? 1.57 29 5 O A LYS 24 ? ? H A GLN 28 ? ? 1.58 30 6 O A ASP 176 ? ? H A THR 178 ? ? 1.51 31 6 O A LEU 27 ? ? H A TYR 31 ? ? 1.56 32 6 O A VAL 68 ? ? H A PHE 72 ? ? 1.57 33 6 HZ2 A LYS 158 ? ? OE2 A GLU 168 ? ? 1.58 34 6 H A SER 117 ? ? OE1 A GLU 120 ? ? 1.60 35 7 O A LYS 24 ? ? H A GLN 28 ? ? 1.52 36 7 O A VAL 68 ? ? H A PHE 72 ? ? 1.55 37 7 O A THR 165 ? ? H A PHE 169 ? ? 1.55 38 7 O A LYS 151 ? ? H A MET 155 ? ? 1.56 39 7 O A ILE 102 ? ? H A GLN 106 ? ? 1.58 40 7 O A SER 173 ? ? H A ASP 176 ? ? 1.59 41 8 HG A SER 40 ? ? H A GLY 41 ? ? 1.19 42 8 O A PRO 139 ? ? H A ASP 141 ? ? 1.53 43 8 O A LYS 151 ? ? H A MET 155 ? ? 1.58 44 8 O A MET 131 ? ? H A SER 134 ? ? 1.58 45 8 O A LEU 27 ? ? H A TYR 31 ? ? 1.59 46 9 O A VAL 68 ? ? H A PHE 72 ? ? 1.50 47 9 O A LEU 27 ? ? H A TYR 31 ? ? 1.53 48 9 O A ILE 102 ? ? H A GLN 106 ? ? 1.55 49 10 O A SER 173 ? ? H A ASP 176 ? ? 1.59 50 10 HD21 A ASN 44 ? ? OE2 A GLU 47 ? ? 1.60 51 11 HH A TYR 118 ? ? HD21 A ASN 150 ? ? 1.29 52 11 O A LEU 27 ? ? H A TYR 31 ? ? 1.56 53 11 O A THR 165 ? ? H A PHE 169 ? ? 1.57 54 11 O A LYS 158 ? ? HD21 A ASN 159 ? ? 1.58 55 11 O A TRP 30 ? ? H A PHE 34 ? ? 1.58 56 12 O A ILE 102 ? ? H A GLN 106 ? ? 1.54 57 12 O A LEU 27 ? ? H A TYR 31 ? ? 1.55 58 12 O A LYS 151 ? ? H A MET 155 ? ? 1.56 59 12 O A VAL 68 ? ? H A PHE 72 ? ? 1.57 60 12 O A ASN 150 ? ? H A ASN 154 ? ? 1.59 61 13 HG A SER 40 ? ? H A GLY 41 ? ? 1.21 62 13 O A VAL 68 ? ? H A PHE 72 ? ? 1.56 63 13 O A ASN 150 ? ? H A ASN 154 ? ? 1.58 64 13 O A PHE 69 ? ? H A ASP 73 ? ? 1.58 65 13 O A PHE 56 ? ? H A PHE 58 ? ? 1.60 66 14 O A VAL 68 ? ? H A PHE 72 ? ? 1.57 67 14 O A LYS 24 ? ? H A GLN 28 ? ? 1.57 68 15 HG A SER 93 ? ? H A ARG 94 ? ? 1.29 69 15 O A PHE 69 ? ? H A ASP 73 ? ? 1.54 70 15 O A LEU 27 ? ? H A TYR 31 ? ? 1.58 71 15 O A SER 62 ? ? H A GLU 66 ? ? 1.60 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.308 1.432 -0.124 0.017 N 2 1 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 3 1 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.309 1.432 -0.123 0.017 N 4 2 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.312 1.432 -0.120 0.017 N 5 2 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 6 2 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.308 1.432 -0.124 0.017 N 7 3 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.309 1.432 -0.123 0.017 N 8 3 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.246 1.369 -0.123 0.015 N 9 3 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.310 1.432 -0.122 0.017 N 10 4 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.310 1.432 -0.122 0.017 N 11 4 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.249 1.369 -0.120 0.015 N 12 4 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.310 1.432 -0.122 0.017 N 13 5 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.313 1.432 -0.119 0.017 N 14 5 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 15 5 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.309 1.432 -0.123 0.017 N 16 6 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.308 1.432 -0.124 0.017 N 17 6 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.249 1.369 -0.120 0.015 N 18 6 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.310 1.432 -0.122 0.017 N 19 7 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.316 1.432 -0.116 0.017 N 20 7 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 21 7 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.311 1.432 -0.121 0.017 N 22 8 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.308 1.432 -0.124 0.017 N 23 8 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.247 1.369 -0.122 0.015 N 24 8 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.310 1.432 -0.122 0.017 N 25 9 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.309 1.432 -0.123 0.017 N 26 9 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 27 9 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.307 1.432 -0.125 0.017 N 28 10 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.310 1.432 -0.122 0.017 N 29 10 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.247 1.369 -0.122 0.015 N 30 10 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.310 1.432 -0.122 0.017 N 31 11 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.312 1.432 -0.120 0.017 N 32 11 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 33 11 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.306 1.432 -0.126 0.017 N 34 12 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.312 1.432 -0.120 0.017 N 35 12 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 36 12 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.308 1.432 -0.124 0.017 N 37 13 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.309 1.432 -0.123 0.017 N 38 13 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.248 1.369 -0.121 0.015 N 39 13 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.309 1.432 -0.123 0.017 N 40 14 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.308 1.432 -0.124 0.017 N 41 14 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.249 1.369 -0.120 0.015 N 42 14 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.309 1.432 -0.123 0.017 N 43 15 CG A TRP 30 ? ? CD2 A TRP 30 ? ? 1.313 1.432 -0.119 0.017 N 44 15 CG A HIS 42 ? ? ND1 A HIS 42 ? ? 1.249 1.369 -0.120 0.015 N 45 15 CG A TRP 103 ? ? CD2 A TRP 103 ? ? 1.310 1.432 -0.122 0.017 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.14 106.30 4.84 0.80 N 2 1 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.61 110.10 -6.49 1.00 N 3 1 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.18 130.40 9.78 1.10 N 4 1 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.82 107.30 -7.48 1.00 N 5 1 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.72 110.10 -6.38 1.00 N 6 1 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.35 130.40 9.95 1.10 N 7 1 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.80 107.30 -7.50 1.00 N 8 2 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.69 110.10 -6.41 1.00 N 9 2 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 139.94 130.40 9.54 1.10 N 10 2 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.93 107.30 -7.37 1.00 N 11 2 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.14 106.30 4.84 0.80 N 12 2 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.66 110.10 -6.44 1.00 N 13 2 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.71 130.40 10.31 1.10 N 14 2 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.62 107.30 -7.68 1.00 N 15 2 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.27 133.90 -5.63 0.90 N 16 3 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.69 110.10 -6.41 1.00 N 17 3 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.31 130.40 9.91 1.10 N 18 3 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.79 107.30 -7.51 1.00 N 19 3 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.68 110.10 -6.42 1.00 N 20 3 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.65 130.40 10.25 1.10 N 21 3 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.68 107.30 -7.62 1.00 N 22 3 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.30 133.90 -5.60 0.90 N 23 4 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.10 106.30 4.80 0.80 N 24 4 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.67 110.10 -6.43 1.00 N 25 4 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.12 130.40 9.72 1.10 N 26 4 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.92 107.30 -7.38 1.00 N 27 4 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.68 110.10 -6.42 1.00 N 28 4 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.60 130.40 10.20 1.10 N 29 4 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.64 107.30 -7.66 1.00 N 30 4 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.50 133.90 -5.40 0.90 N 31 5 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.19 106.30 4.89 0.80 N 32 5 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.63 110.10 -6.47 1.00 N 33 5 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 139.85 130.40 9.45 1.10 N 34 5 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.92 107.30 -7.38 1.00 N 35 5 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.67 110.10 -6.43 1.00 N 36 5 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.20 130.40 9.80 1.10 N 37 5 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.76 107.30 -7.54 1.00 N 38 6 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.18 106.30 4.88 0.80 N 39 6 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.55 110.10 -6.55 1.00 N 40 6 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.01 130.40 9.61 1.10 N 41 6 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.86 107.30 -7.44 1.00 N 42 6 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.16 106.30 4.86 0.80 N 43 6 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.72 110.10 -6.38 1.00 N 44 6 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.71 130.40 10.31 1.10 N 45 6 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.58 107.30 -7.72 1.00 N 46 6 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.50 133.90 -5.40 0.90 N 47 7 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.78 110.10 -6.32 1.00 N 48 7 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 139.82 130.40 9.42 1.10 N 49 7 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 100.00 107.30 -7.30 1.00 N 50 7 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.11 106.30 4.81 0.80 N 51 7 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.76 110.10 -6.34 1.00 N 52 7 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.44 130.40 10.04 1.10 N 53 7 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.72 107.30 -7.58 1.00 N 54 8 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.19 106.30 4.89 0.80 N 55 8 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.61 110.10 -6.49 1.00 N 56 8 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.42 130.40 10.02 1.10 N 57 8 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.71 107.30 -7.59 1.00 N 58 8 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.63 110.10 -6.47 1.00 N 59 8 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.15 130.40 9.75 1.10 N 60 8 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.80 107.30 -7.50 1.00 N 61 9 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.18 106.30 4.88 0.80 N 62 9 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.61 110.10 -6.49 1.00 N 63 9 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.12 130.40 9.72 1.10 N 64 9 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.81 107.30 -7.49 1.00 N 65 9 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.13 106.30 4.83 0.80 N 66 9 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.63 110.10 -6.47 1.00 N 67 9 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.29 130.40 9.89 1.10 N 68 9 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.77 107.30 -7.53 1.00 N 69 10 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.16 106.30 4.86 0.80 N 70 10 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.62 110.10 -6.48 1.00 N 71 10 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.08 130.40 9.68 1.10 N 72 10 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.92 107.30 -7.38 1.00 N 73 10 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.73 110.10 -6.37 1.00 N 74 10 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.37 130.40 9.97 1.10 N 75 10 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.77 107.30 -7.53 1.00 N 76 10 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.41 133.90 -5.49 0.90 N 77 11 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.12 106.30 4.82 0.80 N 78 11 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.73 110.10 -6.37 1.00 N 79 11 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 139.98 130.40 9.58 1.10 N 80 11 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.91 107.30 -7.39 1.00 N 81 11 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.25 106.30 4.95 0.80 N 82 11 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.63 110.10 -6.47 1.00 N 83 11 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.72 130.40 10.32 1.10 N 84 11 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.58 107.30 -7.72 1.00 N 85 11 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.26 133.90 -5.64 0.90 N 86 12 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.14 106.30 4.84 0.80 N 87 12 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.73 110.10 -6.37 1.00 N 88 12 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 139.99 130.40 9.59 1.10 N 89 12 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.90 107.30 -7.40 1.00 N 90 12 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.14 106.30 4.84 0.80 N 91 12 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.67 110.10 -6.43 1.00 N 92 12 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.46 130.40 10.06 1.10 N 93 12 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.69 107.30 -7.61 1.00 N 94 12 CG A TRP 103 ? ? CD2 A TRP 103 ? ? CE3 A TRP 103 ? ? 128.36 133.90 -5.54 0.90 N 95 13 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.29 106.30 4.99 0.80 N 96 13 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.65 110.10 -6.45 1.00 N 97 13 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.21 130.40 9.81 1.10 N 98 13 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.82 107.30 -7.48 1.00 N 99 13 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.58 110.10 -6.52 1.00 N 100 13 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.17 130.40 9.77 1.10 N 101 13 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.85 107.30 -7.45 1.00 N 102 14 CD1 A TRP 30 ? ? CG A TRP 30 ? ? CD2 A TRP 30 ? ? 111.12 106.30 4.82 0.80 N 103 14 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.61 110.10 -6.49 1.00 N 104 14 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.16 130.40 9.76 1.10 N 105 14 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.85 107.30 -7.45 1.00 N 106 14 CD1 A TRP 103 ? ? CG A TRP 103 ? ? CD2 A TRP 103 ? ? 111.19 106.30 4.89 0.80 N 107 14 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.67 110.10 -6.43 1.00 N 108 14 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.64 130.40 10.24 1.10 N 109 14 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.64 107.30 -7.66 1.00 N 110 15 CG A TRP 30 ? ? CD1 A TRP 30 ? ? NE1 A TRP 30 ? ? 103.72 110.10 -6.38 1.00 N 111 15 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CZ2 A TRP 30 ? ? 140.02 130.40 9.62 1.10 N 112 15 NE1 A TRP 30 ? ? CE2 A TRP 30 ? ? CD2 A TRP 30 ? ? 99.89 107.30 -7.41 1.00 N 113 15 CG A TRP 103 ? ? CD1 A TRP 103 ? ? NE1 A TRP 103 ? ? 103.66 110.10 -6.44 1.00 N 114 15 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CZ2 A TRP 103 ? ? 140.60 130.40 10.20 1.10 N 115 15 NE1 A TRP 103 ? ? CE2 A TRP 103 ? ? CD2 A TRP 103 ? ? 99.56 107.30 -7.74 1.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 3 ? ? -142.13 -35.72 2 1 SER A 4 ? ? -141.31 -41.13 3 1 SER A 6 ? ? -55.05 178.68 4 1 PHE A 22 ? ? 121.76 -167.81 5 1 LYS A 24 ? ? -131.35 -60.69 6 1 SER A 40 ? ? -125.30 -51.10 7 1 PHE A 56 ? ? -164.80 74.69 8 1 PHE A 58 ? ? -77.59 -73.51 9 1 ASP A 75 ? ? -174.10 53.76 10 1 ASN A 77 ? ? 71.93 -82.23 11 1 ASP A 109 ? ? -94.47 43.63 12 1 MET A 135 ? ? -109.57 -80.14 13 1 PRO A 139 ? ? -60.33 -162.77 14 1 GLU A 140 ? ? -143.13 43.75 15 1 ASP A 141 ? ? -156.09 15.21 16 1 PRO A 145 ? ? -58.62 -2.02 17 1 ASP A 157 ? ? 62.71 81.39 18 1 ASN A 159 ? ? -79.69 24.22 19 1 LYS A 160 ? ? 50.91 7.10 20 1 ASP A 161 ? ? -160.22 -23.15 21 1 LEU A 185 ? ? -70.74 39.00 22 1 TYR A 186 ? ? -171.21 42.66 23 1 LEU A 189 ? ? -144.01 33.86 24 2 SER A 4 ? ? 70.73 124.99 25 2 GLN A 5 ? ? -84.47 -156.13 26 2 LEU A 8 ? ? -57.71 170.99 27 2 PHE A 22 ? ? -178.00 -178.18 28 2 LYS A 24 ? ? -127.84 -71.54 29 2 LYS A 53 ? ? -66.78 3.98 30 2 PRO A 57 ? ? -56.61 -74.55 31 2 PHE A 58 ? ? -158.53 -79.14 32 2 LYS A 76 ? ? 44.30 29.90 33 2 ASN A 77 ? ? -48.17 -72.06 34 2 THR A 92 ? ? -95.59 -154.04 35 2 SER A 93 ? ? 71.76 -162.49 36 2 ASP A 109 ? ? -145.50 37.94 37 2 PRO A 139 ? ? -63.41 -168.41 38 2 GLU A 140 ? ? -91.79 59.27 39 2 ASP A 141 ? ? -142.31 -46.08 40 2 GLU A 142 ? ? 68.63 -153.55 41 2 ASP A 143 ? ? 63.86 173.51 42 2 PRO A 145 ? ? -60.58 22.84 43 2 LYS A 158 ? ? -67.26 -85.39 44 2 ASN A 159 ? ? -169.84 -100.58 45 2 LYS A 160 ? ? -171.62 -31.28 46 2 SER A 184 ? ? -97.44 -114.32 47 2 LEU A 185 ? ? 63.96 -3.80 48 2 TYR A 186 ? ? -150.44 45.84 49 2 ASP A 187 ? ? -150.72 86.58 50 3 SER A 4 ? ? -55.81 -0.55 51 3 GLN A 5 ? ? 59.99 166.19 52 3 ARG A 18 ? ? -58.97 -9.88 53 3 PHE A 22 ? ? 164.03 168.46 54 3 ASP A 23 ? ? -64.23 -168.98 55 3 LYS A 24 ? ? -146.79 -69.62 56 3 PRO A 39 ? ? -62.94 21.37 57 3 PHE A 55 ? ? -111.67 -74.69 58 3 PRO A 57 ? ? -53.46 -80.20 59 3 PHE A 58 ? ? -172.93 49.75 60 3 ASP A 60 ? ? 41.38 82.65 61 3 ASP A 73 ? ? -151.02 88.98 62 3 ASP A 75 ? ? -173.05 37.15 63 3 ASN A 77 ? ? -144.60 -21.52 64 3 SER A 93 ? ? 173.18 116.62 65 3 TYR A 118 ? ? -38.85 -26.47 66 3 LEU A 138 ? ? -44.58 155.07 67 3 PRO A 139 ? ? -58.69 -159.21 68 3 ASP A 141 ? ? 56.62 -3.15 69 3 THR A 144 ? ? 177.25 66.30 70 3 ASP A 157 ? ? 52.76 79.25 71 3 LYS A 158 ? ? -122.94 -162.68 72 3 LYS A 174 ? ? -52.58 -9.91 73 3 PRO A 177 ? ? -57.36 82.25 74 3 THR A 178 ? ? -170.59 -35.02 75 3 TYR A 186 ? ? -170.97 61.96 76 3 ASP A 187 ? ? -178.26 50.21 77 3 LEU A 189 ? ? -92.30 30.85 78 4 SER A 4 ? ? 41.01 75.82 79 4 GLN A 5 ? ? 47.92 -165.12 80 4 SER A 6 ? ? -103.66 -159.95 81 4 PHE A 22 ? ? -174.63 -157.56 82 4 LYS A 24 ? ? -122.50 -73.12 83 4 CYS A 38 ? ? 178.99 110.15 84 4 PRO A 39 ? ? -58.91 -7.07 85 4 SER A 40 ? ? -55.84 103.21 86 4 PHE A 55 ? ? -102.06 -79.23 87 4 PRO A 57 ? ? -61.89 -77.64 88 4 PHE A 58 ? ? 169.52 69.73 89 4 ASP A 60 ? ? -151.13 68.55 90 4 ALA A 74 ? ? -48.23 -9.07 91 4 ASP A 75 ? ? 79.95 44.96 92 4 LYS A 76 ? ? -124.23 -68.54 93 4 MET A 135 ? ? -86.33 -73.22 94 4 LEU A 138 ? ? 56.07 155.31 95 4 GLU A 140 ? ? -96.13 30.73 96 4 ASP A 141 ? ? -157.91 33.98 97 4 THR A 144 ? ? -39.96 106.34 98 4 PRO A 145 ? ? -64.67 19.05 99 4 ASP A 157 ? ? 63.68 95.37 100 4 PRO A 177 ? ? -58.02 85.21 101 4 THR A 178 ? ? -170.83 -35.57 102 4 SER A 184 ? ? -59.52 2.69 103 4 TYR A 186 ? ? -99.92 30.35 104 4 ASP A 187 ? ? -161.11 33.81 105 5 SER A 4 ? ? -76.93 -74.31 106 5 GLN A 5 ? ? 52.90 -87.57 107 5 SER A 6 ? ? 55.55 -170.66 108 5 LYS A 7 ? ? -146.85 -35.67 109 5 PHE A 22 ? ? -174.46 -154.06 110 5 SER A 40 ? ? -150.71 -107.84 111 5 PHE A 56 ? ? -151.96 65.00 112 5 PRO A 57 ? ? -67.64 63.62 113 5 ASP A 75 ? ? -175.43 56.81 114 5 LYS A 76 ? ? -95.27 -79.38 115 5 ASN A 77 ? ? -152.12 -23.11 116 5 SER A 93 ? ? 173.19 176.76 117 5 GLU A 96 ? ? -86.69 30.20 118 5 LEU A 97 ? ? 66.57 -37.10 119 5 ASP A 109 ? ? -141.99 59.61 120 5 LEU A 110 ? ? -67.56 17.34 121 5 MET A 135 ? ? -95.52 -63.29 122 5 LEU A 138 ? ? -44.39 152.16 123 5 PRO A 139 ? ? -61.93 -155.96 124 5 GLU A 140 ? ? -67.64 40.32 125 5 THR A 144 ? ? 32.01 81.98 126 5 ASP A 157 ? ? 39.49 40.60 127 5 PRO A 177 ? ? -59.61 86.82 128 5 THR A 178 ? ? -176.59 -34.10 129 5 ASP A 187 ? ? -113.29 55.49 130 5 LEU A 189 ? ? -152.42 38.29 131 6 PHE A 22 ? ? -176.57 -177.30 132 6 LYS A 24 ? ? -143.10 -72.96 133 6 LYS A 25 ? ? -46.01 -19.43 134 6 PRO A 39 ? ? -63.61 27.92 135 6 PHE A 56 ? ? -153.57 78.19 136 6 ASP A 75 ? ? -179.78 52.21 137 6 LYS A 76 ? ? -103.43 -79.68 138 6 ASN A 77 ? ? -147.87 -20.24 139 6 SER A 93 ? ? -168.71 118.39 140 6 MET A 135 ? ? -135.29 -68.14 141 6 PRO A 139 ? ? -64.15 -169.61 142 6 GLU A 142 ? ? -52.90 97.70 143 6 THR A 144 ? ? -43.75 109.05 144 6 PRO A 145 ? ? -64.85 14.99 145 6 ASP A 157 ? ? 57.95 88.93 146 6 ASN A 159 ? ? -48.34 163.53 147 6 PRO A 177 ? ? -63.39 48.02 148 6 TYR A 186 ? ? -151.28 46.09 149 6 LEU A 189 ? ? -155.07 33.50 150 7 SER A 4 ? ? 65.88 159.28 151 7 GLN A 5 ? ? -63.11 -89.71 152 7 PHE A 22 ? ? -169.64 -161.86 153 7 LYS A 24 ? ? -120.81 -73.20 154 7 SER A 40 ? ? -158.38 -28.17 155 7 PHE A 56 ? ? -169.81 81.31 156 7 PRO A 57 ? ? -72.17 -85.68 157 7 PHE A 58 ? ? 65.77 -0.24 158 7 ASP A 75 ? ? 157.11 83.49 159 7 LYS A 76 ? ? -153.96 -68.03 160 7 SER A 93 ? ? -167.81 4.36 161 7 ASN A 113 ? ? -140.99 -52.71 162 7 MET A 135 ? ? -153.85 -62.63 163 7 PRO A 139 ? ? -64.49 97.93 164 7 GLU A 140 ? ? -88.02 38.97 165 7 ASP A 141 ? ? -141.98 -42.77 166 7 ASP A 143 ? ? -162.44 -156.00 167 7 THR A 144 ? ? 82.94 63.97 168 7 ASP A 157 ? ? 39.70 36.03 169 7 LYS A 160 ? ? -65.50 31.37 170 7 ASP A 161 ? ? -167.35 -8.24 171 7 PRO A 177 ? ? -63.32 66.49 172 7 THR A 178 ? ? -156.32 -31.71 173 7 TYR A 186 ? ? -88.60 30.50 174 7 LEU A 189 ? ? -144.50 35.06 175 8 SER A 4 ? ? 50.57 7.55 176 8 PHE A 22 ? ? -176.31 -155.46 177 8 SER A 40 ? ? -165.19 -56.74 178 8 PRO A 57 ? ? -60.83 -73.70 179 8 PHE A 58 ? ? -176.98 73.03 180 8 ASP A 60 ? ? 43.18 81.20 181 8 LYS A 76 ? ? 42.47 22.50 182 8 SER A 93 ? ? 61.45 163.98 183 8 ASN A 113 ? ? -135.28 -59.30 184 8 MET A 135 ? ? -147.33 -38.90 185 8 LYS A 137 ? ? -46.21 157.42 186 8 PRO A 139 ? ? -63.36 -153.67 187 8 GLU A 140 ? ? -68.74 51.56 188 8 GLU A 142 ? ? -57.84 79.39 189 8 PRO A 145 ? ? -62.67 4.58 190 8 LYS A 158 ? ? -129.22 -165.81 191 8 ASP A 161 ? ? -169.97 1.98 192 8 PRO A 177 ? ? -63.25 80.66 193 8 THR A 178 ? ? -175.88 -31.00 194 8 SER A 184 ? ? -87.41 -143.09 195 8 LEU A 185 ? ? 59.03 -4.39 196 8 LEU A 189 ? ? -145.90 31.79 197 9 LYS A 3 ? ? -171.94 99.76 198 9 GLN A 5 ? ? -172.25 -21.92 199 9 SER A 6 ? ? 66.69 139.21 200 9 PHE A 22 ? ? -176.10 -176.36 201 9 LYS A 24 ? ? -138.09 -74.70 202 9 LYS A 25 ? ? -46.17 -17.77 203 9 SER A 40 ? ? -166.85 -55.43 204 9 PHE A 55 ? ? -149.01 15.75 205 9 PHE A 56 ? ? -153.24 58.13 206 9 PRO A 57 ? ? -67.80 24.80 207 9 PHE A 58 ? ? -144.63 53.84 208 9 LYS A 76 ? ? 42.61 26.64 209 9 ASN A 77 ? ? -40.95 -83.28 210 9 SER A 93 ? ? -165.59 -139.55 211 9 ARG A 94 ? ? -165.27 35.94 212 9 PRO A 139 ? ? -59.93 101.29 213 9 GLU A 140 ? ? -77.99 48.68 214 9 ASP A 141 ? ? -146.12 23.19 215 9 PRO A 145 ? ? -56.86 -7.55 216 9 LYS A 158 ? ? -97.67 -141.04 217 9 LYS A 160 ? ? 51.04 9.53 218 9 ASP A 161 ? ? -142.79 -28.04 219 9 PRO A 177 ? ? -62.95 14.49 220 9 LEU A 185 ? ? -66.31 12.67 221 9 TYR A 186 ? ? -142.24 43.58 222 9 LEU A 189 ? ? -168.00 37.24 223 10 LYS A 3 ? ? -67.67 28.69 224 10 SER A 4 ? ? -71.83 -161.62 225 10 LYS A 24 ? ? -131.56 -49.98 226 10 PRO A 39 ? ? -64.56 25.30 227 10 SER A 40 ? ? -72.76 -92.86 228 10 PHE A 56 ? ? -157.86 68.46 229 10 ASP A 73 ? ? -151.06 83.72 230 10 ASP A 75 ? ? -174.01 40.22 231 10 LYS A 76 ? ? -95.16 -72.97 232 10 ASN A 77 ? ? -141.41 -19.83 233 10 SER A 93 ? ? 70.42 125.22 234 10 GLN A 106 ? ? -55.23 -9.73 235 10 ASP A 109 ? ? -79.25 37.20 236 10 LYS A 137 ? ? -62.39 84.99 237 10 LEU A 138 ? ? -27.82 96.23 238 10 GLU A 140 ? ? -80.45 43.92 239 10 PRO A 145 ? ? -61.59 13.06 240 10 MET A 156 ? ? -168.23 -43.98 241 10 ASP A 157 ? ? -45.64 162.64 242 10 LYS A 158 ? ? -55.25 -168.64 243 10 PRO A 177 ? ? -62.35 16.58 244 10 ASP A 187 ? ? -107.47 54.73 245 10 LEU A 189 ? ? -165.21 36.39 246 11 SER A 4 ? ? -91.24 31.99 247 11 SER A 6 ? ? 67.51 130.47 248 11 PHE A 22 ? ? -176.67 -153.85 249 11 LYS A 24 ? ? -99.59 -69.83 250 11 CYS A 38 ? ? -153.69 80.24 251 11 PRO A 39 ? ? -63.15 2.20 252 11 SER A 40 ? ? -59.49 96.72 253 11 PRO A 57 ? ? -53.89 -79.04 254 11 PHE A 58 ? ? -173.44 -70.76 255 11 LYS A 76 ? ? 41.94 21.27 256 11 ASN A 77 ? ? -42.57 -79.08 257 11 SER A 93 ? ? -168.89 -164.53 258 11 ARG A 94 ? ? -142.23 -159.05 259 11 MET A 135 ? ? -94.19 -73.80 260 11 LYS A 137 ? ? -72.46 -160.28 261 11 GLU A 140 ? ? -100.66 50.28 262 11 ASP A 141 ? ? -145.66 -13.25 263 11 GLU A 142 ? ? -155.51 60.77 264 11 THR A 144 ? ? 179.92 64.43 265 11 LYS A 158 ? ? -84.38 -136.09 266 11 LYS A 174 ? ? -55.95 -0.55 267 11 PRO A 177 ? ? -63.70 78.08 268 11 THR A 178 ? ? -170.13 -33.28 269 11 TYR A 186 ? ? -140.15 29.92 270 11 LEU A 189 ? ? -156.76 35.98 271 12 GLN A 5 ? ? -143.34 56.05 272 12 PHE A 22 ? ? -176.97 -175.09 273 12 LYS A 24 ? ? -128.38 -65.43 274 12 PRO A 39 ? ? -65.94 32.03 275 12 PHE A 56 ? ? -156.90 67.57 276 12 ASN A 77 ? ? -65.32 -85.10 277 12 THR A 92 ? ? -78.97 -168.17 278 12 SER A 93 ? ? 64.28 178.05 279 12 ASN A 113 ? ? -152.49 -47.36 280 12 MET A 135 ? ? -101.10 -78.25 281 12 GLU A 140 ? ? -150.04 58.57 282 12 ASP A 141 ? ? 174.71 0.43 283 12 ASP A 143 ? ? -54.84 173.25 284 12 ASP A 157 ? ? 58.11 85.29 285 12 SER A 184 ? ? -64.17 95.46 286 12 LEU A 185 ? ? -132.62 -50.19 287 12 ASP A 187 ? ? -144.16 41.35 288 12 LEU A 189 ? ? -150.36 35.87 289 13 LYS A 3 ? ? -162.18 108.23 290 13 SER A 4 ? ? 47.95 91.61 291 13 GLN A 5 ? ? -138.12 -105.88 292 13 SER A 6 ? ? 64.26 152.08 293 13 LEU A 8 ? ? -88.43 -159.45 294 13 LYS A 24 ? ? -135.72 -56.39 295 13 PRO A 39 ? ? -63.57 13.67 296 13 PRO A 57 ? ? -62.43 28.42 297 13 PHE A 58 ? ? -87.85 -74.49 298 13 ASP A 60 ? ? 37.84 58.38 299 13 ASN A 70 ? ? -49.08 -17.68 300 13 ASP A 73 ? ? -150.38 87.84 301 13 ASN A 77 ? ? -54.75 -83.15 302 13 THR A 92 ? ? -99.09 59.52 303 13 PRO A 139 ? ? -57.92 101.50 304 13 ASP A 141 ? ? -160.86 -21.77 305 13 GLU A 142 ? ? -170.79 126.64 306 13 THR A 144 ? ? -178.17 77.75 307 13 PRO A 177 ? ? -63.22 67.66 308 13 THR A 178 ? ? -157.45 -32.73 309 13 TYR A 186 ? ? -146.26 49.48 310 13 ASP A 187 ? ? -150.60 61.19 311 14 LYS A 3 ? ? -160.07 -169.79 312 14 GLN A 5 ? ? -155.45 -72.71 313 14 SER A 6 ? ? 44.04 90.54 314 14 PHE A 22 ? ? -175.85 -179.23 315 14 LYS A 24 ? ? -132.36 -82.21 316 14 PRO A 39 ? ? -65.81 22.62 317 14 PHE A 55 ? ? -93.16 -77.52 318 14 PHE A 56 ? ? -44.85 150.67 319 14 PRO A 57 ? ? -56.85 -75.62 320 14 PHE A 58 ? ? -173.28 -67.31 321 14 ASP A 73 ? ? -97.44 -129.96 322 14 ALA A 74 ? ? 81.60 2.52 323 14 ASP A 75 ? ? -141.12 34.94 324 14 LYS A 76 ? ? 178.70 76.28 325 14 ASN A 77 ? ? 64.97 -80.45 326 14 GLU A 96 ? ? -74.20 -161.17 327 14 ASP A 109 ? ? -140.60 47.91 328 14 LEU A 110 ? ? -78.28 20.76 329 14 MET A 135 ? ? -107.14 -80.17 330 14 GLU A 140 ? ? -68.46 63.73 331 14 ASP A 141 ? ? -176.63 77.01 332 14 GLU A 142 ? ? -22.86 110.61 333 14 ASP A 143 ? ? -73.80 -158.29 334 14 ASP A 157 ? ? 66.50 89.29 335 14 PRO A 177 ? ? -62.37 84.21 336 14 THR A 178 ? ? -167.00 -34.15 337 14 ASP A 187 ? ? -115.39 54.23 338 14 LEU A 189 ? ? -154.10 34.34 339 15 LYS A 3 ? ? 49.86 19.80 340 15 ARG A 21 ? ? -65.62 -144.11 341 15 PHE A 22 ? ? 58.08 164.81 342 15 ASP A 23 ? ? -53.37 -176.42 343 15 LYS A 24 ? ? -136.12 -55.70 344 15 PRO A 39 ? ? -63.76 17.15 345 15 PRO A 57 ? ? -73.75 22.06 346 15 LYS A 76 ? ? 44.04 15.29 347 15 ARG A 94 ? ? -101.36 -162.06 348 15 GLU A 96 ? ? -72.20 -166.04 349 15 ASP A 109 ? ? -145.88 57.13 350 15 MET A 135 ? ? -92.08 -75.81 351 15 PRO A 139 ? ? -60.80 -159.88 352 15 ASP A 141 ? ? -141.49 28.19 353 15 GLU A 142 ? ? 65.54 -157.55 354 15 THR A 144 ? ? -164.69 61.40 355 15 ASP A 157 ? ? 43.10 78.71 356 15 LYS A 160 ? ? 44.98 25.50 357 15 ASP A 161 ? ? -166.84 -18.33 358 15 ASP A 187 ? ? -148.26 28.19 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 18 ? ? 0.294 'SIDE CHAIN' 2 1 ARG A 21 ? ? 0.304 'SIDE CHAIN' 3 1 ARG A 94 ? ? 0.166 'SIDE CHAIN' 4 1 ARG A 123 ? ? 0.254 'SIDE CHAIN' 5 1 ARG A 175 ? ? 0.214 'SIDE CHAIN' 6 2 ARG A 18 ? ? 0.245 'SIDE CHAIN' 7 2 ARG A 94 ? ? 0.169 'SIDE CHAIN' 8 2 ARG A 123 ? ? 0.293 'SIDE CHAIN' 9 2 ARG A 148 ? ? 0.318 'SIDE CHAIN' 10 2 ARG A 175 ? ? 0.174 'SIDE CHAIN' 11 3 ARG A 18 ? ? 0.246 'SIDE CHAIN' 12 3 ARG A 21 ? ? 0.120 'SIDE CHAIN' 13 3 ARG A 94 ? ? 0.301 'SIDE CHAIN' 14 3 ARG A 123 ? ? 0.287 'SIDE CHAIN' 15 3 ARG A 148 ? ? 0.255 'SIDE CHAIN' 16 3 ARG A 175 ? ? 0.173 'SIDE CHAIN' 17 4 ARG A 21 ? ? 0.313 'SIDE CHAIN' 18 4 ARG A 94 ? ? 0.317 'SIDE CHAIN' 19 4 ARG A 123 ? ? 0.318 'SIDE CHAIN' 20 4 ARG A 148 ? ? 0.305 'SIDE CHAIN' 21 4 ARG A 175 ? ? 0.312 'SIDE CHAIN' 22 5 ARG A 18 ? ? 0.318 'SIDE CHAIN' 23 5 ARG A 21 ? ? 0.274 'SIDE CHAIN' 24 5 ARG A 94 ? ? 0.295 'SIDE CHAIN' 25 5 ARG A 148 ? ? 0.091 'SIDE CHAIN' 26 5 ARG A 175 ? ? 0.219 'SIDE CHAIN' 27 6 ARG A 18 ? ? 0.239 'SIDE CHAIN' 28 6 ARG A 94 ? ? 0.121 'SIDE CHAIN' 29 6 ARG A 148 ? ? 0.319 'SIDE CHAIN' 30 6 ARG A 175 ? ? 0.311 'SIDE CHAIN' 31 7 ARG A 18 ? ? 0.205 'SIDE CHAIN' 32 7 ARG A 21 ? ? 0.186 'SIDE CHAIN' 33 7 ARG A 94 ? ? 0.212 'SIDE CHAIN' 34 7 ARG A 123 ? ? 0.143 'SIDE CHAIN' 35 7 ARG A 148 ? ? 0.271 'SIDE CHAIN' 36 7 ARG A 175 ? ? 0.315 'SIDE CHAIN' 37 8 ARG A 18 ? ? 0.293 'SIDE CHAIN' 38 8 ARG A 21 ? ? 0.206 'SIDE CHAIN' 39 8 ARG A 94 ? ? 0.210 'SIDE CHAIN' 40 8 ARG A 123 ? ? 0.319 'SIDE CHAIN' 41 8 ARG A 148 ? ? 0.282 'SIDE CHAIN' 42 8 ARG A 175 ? ? 0.131 'SIDE CHAIN' 43 9 ARG A 18 ? ? 0.268 'SIDE CHAIN' 44 9 ARG A 21 ? ? 0.319 'SIDE CHAIN' 45 9 ARG A 94 ? ? 0.157 'SIDE CHAIN' 46 9 ARG A 123 ? ? 0.178 'SIDE CHAIN' 47 9 ARG A 148 ? ? 0.217 'SIDE CHAIN' 48 9 ARG A 175 ? ? 0.183 'SIDE CHAIN' 49 10 ARG A 18 ? ? 0.282 'SIDE CHAIN' 50 10 ARG A 21 ? ? 0.319 'SIDE CHAIN' 51 10 ARG A 123 ? ? 0.313 'SIDE CHAIN' 52 10 ARG A 148 ? ? 0.317 'SIDE CHAIN' 53 10 ARG A 175 ? ? 0.101 'SIDE CHAIN' 54 11 ARG A 18 ? ? 0.113 'SIDE CHAIN' 55 11 ARG A 21 ? ? 0.213 'SIDE CHAIN' 56 11 ARG A 94 ? ? 0.317 'SIDE CHAIN' 57 11 ARG A 123 ? ? 0.312 'SIDE CHAIN' 58 11 ARG A 148 ? ? 0.247 'SIDE CHAIN' 59 11 ARG A 175 ? ? 0.303 'SIDE CHAIN' 60 12 ARG A 18 ? ? 0.314 'SIDE CHAIN' 61 12 ARG A 21 ? ? 0.317 'SIDE CHAIN' 62 12 ARG A 94 ? ? 0.193 'SIDE CHAIN' 63 12 ARG A 123 ? ? 0.315 'SIDE CHAIN' 64 12 ARG A 148 ? ? 0.318 'SIDE CHAIN' 65 13 ARG A 18 ? ? 0.312 'SIDE CHAIN' 66 13 ARG A 21 ? ? 0.311 'SIDE CHAIN' 67 13 ARG A 94 ? ? 0.175 'SIDE CHAIN' 68 13 ARG A 123 ? ? 0.314 'SIDE CHAIN' 69 13 ARG A 148 ? ? 0.234 'SIDE CHAIN' 70 14 ARG A 21 ? ? 0.270 'SIDE CHAIN' 71 14 ARG A 94 ? ? 0.144 'SIDE CHAIN' 72 14 ARG A 123 ? ? 0.195 'SIDE CHAIN' 73 14 ARG A 148 ? ? 0.317 'SIDE CHAIN' 74 14 ARG A 175 ? ? 0.308 'SIDE CHAIN' 75 15 ARG A 18 ? ? 0.310 'SIDE CHAIN' 76 15 ARG A 21 ? ? 0.081 'SIDE CHAIN' 77 15 ARG A 94 ? ? 0.241 'SIDE CHAIN' 78 15 ARG A 123 ? ? 0.178 'SIDE CHAIN' 79 15 ARG A 148 ? ? 0.278 'SIDE CHAIN' 80 15 ARG A 175 ? ? 0.311 'SIDE CHAIN' #