data_2L31 # _entry.id 2L31 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L31 pdb_00002l31 10.2210/pdb2l31/pdb RCSB RCSB101893 ? ? WWPDB D_1000101893 ? ? BMRB 17158 ? 10.13018/BMR17158 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-02-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-01-11 4 'Structure model' 1 3 2020-02-26 5 'Structure model' 1 4 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' 9 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' chem_comp_atom 6 5 'Structure model' chem_comp_bond 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_struct_conn_angle 9 5 'Structure model' struct_conn 10 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.value' 17 5 'Structure model' '_struct_conn.pdbx_dist_value' 18 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 19 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 20 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 23 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L31 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2010-08-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2L30 . unspecified BMRB 17158 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Neuhaus, D.' 1 'Eustermann, S.' 2 'Yang, J.' 3 'Videler, H.' 4 # _citation.id primary _citation.title 'The DNA-binding domain of human PARP-1 interacts with DNA single-strand breaks as a monomer through its second zinc finger.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 407 _citation.page_first 149 _citation.page_last 170 _citation.year 2011 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21262234 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2011.01.034 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Eustermann, S.' 1 ? primary 'Videler, H.' 2 ? primary 'Yang, J.C.' 3 ? primary 'Cole, P.T.' 4 ? primary 'Gruszka, D.' 5 ? primary 'Veprintsev, D.' 6 ? primary 'Neuhaus, D.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Poly [ADP-ribose] polymerase 1' 12594.448 1 2.4.2.30 ? 'Finger_2 (UNP residues 103-214)' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PARP-1, NAD(+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] synthase 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLK GFSLLATEDKEALKKQLPGVKSEGKRKGDEVD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLK GFSLLATEDKEALKKQLPGVKSEGKRKGDEVD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 ALA n 1 5 GLU n 1 6 LYS n 1 7 THR n 1 8 LEU n 1 9 GLY n 1 10 ASP n 1 11 PHE n 1 12 ALA n 1 13 ALA n 1 14 GLU n 1 15 TYR n 1 16 ALA n 1 17 LYS n 1 18 SER n 1 19 ASN n 1 20 ARG n 1 21 SER n 1 22 THR n 1 23 CYS n 1 24 LYS n 1 25 GLY n 1 26 CYS n 1 27 MET n 1 28 GLU n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 LYS n 1 33 GLY n 1 34 GLN n 1 35 VAL n 1 36 ARG n 1 37 LEU n 1 38 SER n 1 39 LYS n 1 40 LYS n 1 41 MET n 1 42 VAL n 1 43 ASP n 1 44 PRO n 1 45 GLU n 1 46 LYS n 1 47 PRO n 1 48 GLN n 1 49 LEU n 1 50 GLY n 1 51 MET n 1 52 ILE n 1 53 ASP n 1 54 ARG n 1 55 TRP n 1 56 TYR n 1 57 HIS n 1 58 PRO n 1 59 GLY n 1 60 CYS n 1 61 PHE n 1 62 VAL n 1 63 LYS n 1 64 ASN n 1 65 ARG n 1 66 GLU n 1 67 GLU n 1 68 LEU n 1 69 GLY n 1 70 PHE n 1 71 ARG n 1 72 PRO n 1 73 GLU n 1 74 TYR n 1 75 SER n 1 76 ALA n 1 77 SER n 1 78 GLN n 1 79 LEU n 1 80 LYS n 1 81 GLY n 1 82 PHE n 1 83 SER n 1 84 LEU n 1 85 LEU n 1 86 ALA n 1 87 THR n 1 88 GLU n 1 89 ASP n 1 90 LYS n 1 91 GLU n 1 92 ALA n 1 93 LEU n 1 94 LYS n 1 95 LYS n 1 96 GLN n 1 97 LEU n 1 98 PRO n 1 99 GLY n 1 100 VAL n 1 101 LYS n 1 102 SER n 1 103 GLU n 1 104 GLY n 1 105 LYS n 1 106 ARG n 1 107 LYS n 1 108 GLY n 1 109 ASP n 1 110 GLU n 1 111 VAL n 1 112 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PARP1, ADPRT, PPOL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector PET28A _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 103 1 GLY GLY A . n A 1 2 SER 2 104 2 SER SER A . n A 1 3 LYS 3 105 3 LYS LYS A . n A 1 4 ALA 4 106 4 ALA ALA A . n A 1 5 GLU 5 107 5 GLU GLU A . n A 1 6 LYS 6 108 6 LYS LYS A . n A 1 7 THR 7 109 7 THR THR A . n A 1 8 LEU 8 110 8 LEU LEU A . n A 1 9 GLY 9 111 9 GLY GLY A . n A 1 10 ASP 10 112 10 ASP ASP A . n A 1 11 PHE 11 113 11 PHE PHE A . n A 1 12 ALA 12 114 12 ALA ALA A . n A 1 13 ALA 13 115 13 ALA ALA A . n A 1 14 GLU 14 116 14 GLU GLU A . n A 1 15 TYR 15 117 15 TYR TYR A . n A 1 16 ALA 16 118 16 ALA ALA A . n A 1 17 LYS 17 119 17 LYS LYS A . n A 1 18 SER 18 120 18 SER SER A . n A 1 19 ASN 19 121 19 ASN ASN A . n A 1 20 ARG 20 122 20 ARG ARG A . n A 1 21 SER 21 123 21 SER SER A . n A 1 22 THR 22 124 22 THR THR A . n A 1 23 CYS 23 125 23 CYS CYS A . n A 1 24 LYS 24 126 24 LYS LYS A . n A 1 25 GLY 25 127 25 GLY GLY A . n A 1 26 CYS 26 128 26 CYS CYS A . n A 1 27 MET 27 129 27 MET MET A . n A 1 28 GLU 28 130 28 GLU GLU A . n A 1 29 LYS 29 131 29 LYS LYS A . n A 1 30 ILE 30 132 30 ILE ILE A . n A 1 31 GLU 31 133 31 GLU GLU A . n A 1 32 LYS 32 134 32 LYS LYS A . n A 1 33 GLY 33 135 33 GLY GLY A . n A 1 34 GLN 34 136 34 GLN GLN A . n A 1 35 VAL 35 137 35 VAL VAL A . n A 1 36 ARG 36 138 36 ARG ARG A . n A 1 37 LEU 37 139 37 LEU LEU A . n A 1 38 SER 38 140 38 SER SER A . n A 1 39 LYS 39 141 39 LYS LYS A . n A 1 40 LYS 40 142 40 LYS LYS A . n A 1 41 MET 41 143 41 MET MET A . n A 1 42 VAL 42 144 42 VAL VAL A . n A 1 43 ASP 43 145 43 ASP ASP A . n A 1 44 PRO 44 146 44 PRO PRO A . n A 1 45 GLU 45 147 45 GLU GLU A . n A 1 46 LYS 46 148 46 LYS LYS A . n A 1 47 PRO 47 149 47 PRO PRO A . n A 1 48 GLN 48 150 48 GLN GLN A . n A 1 49 LEU 49 151 49 LEU LEU A . n A 1 50 GLY 50 152 50 GLY GLY A . n A 1 51 MET 51 153 51 MET MET A . n A 1 52 ILE 52 154 52 ILE ILE A . n A 1 53 ASP 53 155 53 ASP ASP A . n A 1 54 ARG 54 156 54 ARG ARG A . n A 1 55 TRP 55 157 55 TRP TRP A . n A 1 56 TYR 56 158 56 TYR TYR A . n A 1 57 HIS 57 159 57 HIS HIS A . n A 1 58 PRO 58 160 58 PRO PRO A . n A 1 59 GLY 59 161 59 GLY GLY A . n A 1 60 CYS 60 162 60 CYS CYS A . n A 1 61 PHE 61 163 61 PHE PHE A . n A 1 62 VAL 62 164 62 VAL VAL A . n A 1 63 LYS 63 165 63 LYS LYS A . n A 1 64 ASN 64 166 64 ASN ASN A . n A 1 65 ARG 65 167 65 ARG ARG A . n A 1 66 GLU 66 168 66 GLU GLU A . n A 1 67 GLU 67 169 67 GLU GLU A . n A 1 68 LEU 68 170 68 LEU LEU A . n A 1 69 GLY 69 171 69 GLY GLY A . n A 1 70 PHE 70 172 70 PHE PHE A . n A 1 71 ARG 71 173 71 ARG ARG A . n A 1 72 PRO 72 174 72 PRO PRO A . n A 1 73 GLU 73 175 73 GLU GLU A . n A 1 74 TYR 74 176 74 TYR TYR A . n A 1 75 SER 75 177 75 SER SER A . n A 1 76 ALA 76 178 76 ALA ALA A . n A 1 77 SER 77 179 77 SER SER A . n A 1 78 GLN 78 180 78 GLN GLN A . n A 1 79 LEU 79 181 79 LEU LEU A . n A 1 80 LYS 80 182 80 LYS LYS A . n A 1 81 GLY 81 183 81 GLY GLY A . n A 1 82 PHE 82 184 82 PHE PHE A . n A 1 83 SER 83 185 83 SER SER A . n A 1 84 LEU 84 186 84 LEU LEU A . n A 1 85 LEU 85 187 85 LEU LEU A . n A 1 86 ALA 86 188 86 ALA ALA A . n A 1 87 THR 87 189 87 THR THR A . n A 1 88 GLU 88 190 88 GLU GLU A . n A 1 89 ASP 89 191 89 ASP ASP A . n A 1 90 LYS 90 192 90 LYS LYS A . n A 1 91 GLU 91 193 91 GLU GLU A . n A 1 92 ALA 92 194 92 ALA ALA A . n A 1 93 LEU 93 195 93 LEU LEU A . n A 1 94 LYS 94 196 94 LYS LYS A . n A 1 95 LYS 95 197 95 LYS LYS A . n A 1 96 GLN 96 198 96 GLN GLN A . n A 1 97 LEU 97 199 97 LEU LEU A . n A 1 98 PRO 98 200 98 PRO PRO A . n A 1 99 GLY 99 201 99 GLY GLY A . n A 1 100 VAL 100 202 100 VAL VAL A . n A 1 101 LYS 101 203 101 LYS LYS A . n A 1 102 SER 102 204 102 SER SER A . n A 1 103 GLU 103 205 103 GLU GLU A . n A 1 104 GLY 104 206 104 GLY GLY A . n A 1 105 LYS 105 207 105 LYS LYS A . n A 1 106 ARG 106 208 106 ARG ARG A . n A 1 107 LYS 107 209 107 LYS LYS A . n A 1 108 GLY 108 210 108 GLY GLY A . n A 1 109 ASP 109 211 109 ASP ASP A . n A 1 110 GLU 110 212 110 GLU GLU A . n A 1 111 VAL 111 213 111 VAL VAL A . n A 1 112 ASP 112 214 112 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 215 _pdbx_nonpoly_scheme.auth_seq_num 113 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2L31 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2L31 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L31 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L31 _struct.title 'Human PARP-1 zinc finger 2' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L31 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'zinc finger, TRANSFERASE, DNA REPAIR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PARP1_HUMAN _struct_ref.pdbx_db_accession P09874 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLK GFSLLATEDKEALKKQLPGVKSEGKRKGDEVD ; _struct_ref.pdbx_align_begin 103 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L31 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 112 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P09874 _struct_ref_seq.db_align_beg 103 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 103 _struct_ref_seq.pdbx_auth_seq_align_end 214 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 46 ? LEU A 49 ? LYS A 148 LEU A 151 5 ? 4 HELX_P HELX_P2 2 GLY A 59 ? ASN A 64 ? GLY A 161 ASN A 166 1 ? 6 HELX_P HELX_P3 3 ASN A 64 ? GLY A 69 ? ASN A 166 GLY A 171 1 ? 6 HELX_P HELX_P4 4 ARG A 71 ? LEU A 79 ? ARG A 173 LEU A 181 5 ? 9 HELX_P HELX_P5 5 GLY A 81 ? LEU A 85 ? GLY A 183 LEU A 187 5 ? 5 HELX_P HELX_P6 6 ALA A 86 ? LEU A 97 ? ALA A 188 LEU A 199 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 23 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 125 A ZN 215 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc2 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 128 A ZN 215 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc3 metalc ? ? A HIS 57 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 159 A ZN 215 1_555 ? ? ? ? ? ? ? 2.002 ? ? metalc4 metalc ? ? A CYS 60 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 162 A ZN 215 1_555 ? ? ? ? ? ? ? 2.338 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 23 ? A CYS 125 ? 1_555 ZN ? B ZN . ? A ZN 215 ? 1_555 SG ? A CYS 26 ? A CYS 128 ? 1_555 106.1 ? 2 SG ? A CYS 23 ? A CYS 125 ? 1_555 ZN ? B ZN . ? A ZN 215 ? 1_555 ND1 ? A HIS 57 ? A HIS 159 ? 1_555 99.6 ? 3 SG ? A CYS 26 ? A CYS 128 ? 1_555 ZN ? B ZN . ? A ZN 215 ? 1_555 ND1 ? A HIS 57 ? A HIS 159 ? 1_555 115.2 ? 4 SG ? A CYS 23 ? A CYS 125 ? 1_555 ZN ? B ZN . ? A ZN 215 ? 1_555 SG ? A CYS 60 ? A CYS 162 ? 1_555 106.4 ? 5 SG ? A CYS 26 ? A CYS 128 ? 1_555 ZN ? B ZN . ? A ZN 215 ? 1_555 SG ? A CYS 60 ? A CYS 162 ? 1_555 111.5 ? 6 ND1 ? A HIS 57 ? A HIS 159 ? 1_555 ZN ? B ZN . ? A ZN 215 ? 1_555 SG ? A CYS 60 ? A CYS 162 ? 1_555 116.4 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 11 ? TYR A 15 ? PHE A 113 TYR A 117 A 2 VAL A 35 ? VAL A 42 ? VAL A 137 VAL A 144 A 3 MET A 51 ? TYR A 56 ? MET A 153 TYR A 158 B 1 THR A 22 ? CYS A 23 ? THR A 124 CYS A 125 B 2 GLU A 28 ? LYS A 29 ? GLU A 130 LYS A 131 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 14 ? N GLU A 116 O ARG A 36 ? O ARG A 138 A 2 3 N MET A 41 ? N MET A 143 O ILE A 52 ? O ILE A 154 B 1 2 N CYS A 23 ? N CYS A 125 O GLU A 28 ? O GLU A 130 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 215 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 215' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 23 ? CYS A 125 . ? 1_555 ? 2 AC1 4 CYS A 26 ? CYS A 128 . ? 1_555 ? 3 AC1 4 HIS A 57 ? HIS A 159 . ? 1_555 ? 4 AC1 4 CYS A 60 ? CYS A 162 . ? 1_555 ? # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.99 120.30 3.69 0.50 N 2 1 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.44 120.30 3.14 0.50 N 3 2 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.50 120.30 3.20 0.50 N 4 2 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.59 120.30 3.29 0.50 N 5 2 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 124.05 120.30 3.75 0.50 N 6 4 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.43 120.30 4.13 0.50 N 7 5 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.52 120.30 3.22 0.50 N 8 5 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.71 120.30 4.41 0.50 N 9 6 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.33 120.30 3.03 0.50 N 10 6 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.85 120.30 3.55 0.50 N 11 6 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.36 120.30 3.06 0.50 N 12 6 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.90 120.30 3.60 0.50 N 13 8 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.84 120.30 3.54 0.50 N 14 8 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.53 120.30 3.23 0.50 N 15 8 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.35 120.30 3.05 0.50 N 16 9 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 124.55 120.30 4.25 0.50 N 17 11 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.56 120.30 3.26 0.50 N 18 11 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.30 120.30 4.00 0.50 N 19 11 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.34 120.30 3.04 0.50 N 20 11 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.88 120.30 3.58 0.50 N 21 12 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.51 120.30 3.21 0.50 N 22 12 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.67 120.30 3.37 0.50 N 23 13 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.48 120.30 3.18 0.50 N 24 13 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.57 120.30 3.27 0.50 N 25 13 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH2 A ARG 156 ? ? 117.24 120.30 -3.06 0.50 N 26 14 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.66 120.30 3.36 0.50 N 27 14 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.77 120.30 3.47 0.50 N 28 15 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.38 120.30 3.08 0.50 N 29 15 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.70 120.30 4.40 0.50 N 30 15 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.62 120.30 3.32 0.50 N 31 16 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.33 120.30 3.03 0.50 N 32 17 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.52 120.30 3.22 0.50 N 33 17 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.73 120.30 3.43 0.50 N 34 18 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.78 120.30 3.48 0.50 N 35 19 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.04 120.30 3.74 0.50 N 36 19 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 125.24 120.30 4.94 0.50 N 37 20 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.31 120.30 3.01 0.50 N 38 20 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.53 120.30 4.23 0.50 N 39 20 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.35 120.30 3.05 0.50 N 40 21 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 123.68 120.30 3.38 0.50 N 41 22 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.93 120.30 3.63 0.50 N 42 22 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.42 120.30 3.12 0.50 N 43 23 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.38 120.30 3.08 0.50 N 44 24 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.41 120.30 3.11 0.50 N 45 24 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.33 120.30 3.03 0.50 N 46 25 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.83 120.30 3.53 0.50 N 47 25 NE A ARG 173 ? ? CZ A ARG 173 ? ? NH1 A ARG 173 ? ? 123.68 120.30 3.38 0.50 N 48 26 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 124.13 120.30 3.83 0.50 N 49 27 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.79 120.30 3.49 0.50 N 50 27 NE A ARG 208 ? ? CZ A ARG 208 ? ? NH1 A ARG 208 ? ? 123.72 120.30 3.42 0.50 N 51 28 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.53 120.30 3.23 0.50 N 52 28 NE A ARG 156 ? ? CZ A ARG 156 ? ? NH1 A ARG 156 ? ? 124.79 120.30 4.49 0.50 N 53 29 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.85 120.30 3.55 0.50 N 54 30 NE A ARG 138 ? ? CZ A ARG 138 ? ? NH1 A ARG 138 ? ? 123.92 120.30 3.62 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 112 ? ? -151.96 -26.43 2 1 ALA A 118 ? ? -66.38 99.40 3 1 CYS A 128 ? ? -141.08 -2.20 4 1 TYR A 176 ? ? -148.68 58.62 5 1 SER A 177 ? ? -74.33 -154.76 6 1 ASP A 211 ? ? -148.31 58.01 7 1 VAL A 213 ? ? -143.11 12.28 8 2 ASP A 112 ? ? -151.86 -31.16 9 2 ALA A 118 ? ? -68.33 94.62 10 2 ASN A 121 ? ? -77.43 29.65 11 2 CYS A 128 ? ? -140.30 -0.19 12 2 LYS A 148 ? ? -140.36 52.43 13 2 TYR A 176 ? ? -148.79 50.67 14 2 SER A 204 ? ? 61.62 -14.37 15 3 ALA A 106 ? ? -96.03 57.99 16 3 ASP A 112 ? ? -141.07 -12.67 17 3 TYR A 176 ? ? -149.35 59.52 18 3 LYS A 203 ? ? -80.32 41.79 19 4 LYS A 148 ? ? -145.89 56.42 20 4 TYR A 176 ? ? -150.27 59.44 21 4 SER A 177 ? ? -73.09 -164.34 22 5 LYS A 108 ? ? 57.48 -168.79 23 5 ASP A 112 ? ? -150.13 -29.97 24 5 LYS A 148 ? ? -145.09 59.02 25 5 SER A 177 ? ? -55.59 -177.93 26 5 VAL A 202 ? ? 55.63 120.00 27 6 LYS A 148 ? ? -144.04 57.64 28 6 SER A 177 ? ? -56.82 -173.87 29 6 SER A 204 ? ? -172.84 -38.77 30 6 VAL A 213 ? ? -83.33 42.43 31 7 CYS A 128 ? ? -143.23 -2.32 32 7 SER A 177 ? ? -60.20 -174.08 33 7 LYS A 203 ? ? -68.80 16.62 34 8 ASN A 121 ? ? -79.43 24.49 35 8 TYR A 176 ? ? -147.65 43.77 36 8 SER A 177 ? ? -64.47 -170.87 37 8 LYS A 203 ? ? -108.41 58.93 38 9 ALA A 106 ? ? 59.61 162.39 39 9 ASP A 112 ? ? -140.07 -13.58 40 9 LYS A 148 ? ? -140.77 56.10 41 9 SER A 177 ? ? -55.41 -173.40 42 9 SER A 204 ? ? 63.49 -45.14 43 10 ASP A 112 ? ? -140.07 -15.74 44 10 ASN A 121 ? ? -77.41 34.40 45 10 SER A 177 ? ? -65.89 -168.02 46 11 ALA A 106 ? ? 59.32 149.23 47 11 ASP A 112 ? ? -140.97 -12.85 48 11 LYS A 148 ? ? -148.49 55.97 49 11 LYS A 207 ? ? -142.60 -5.74 50 12 LYS A 108 ? ? -146.81 -59.50 51 12 SER A 177 ? ? -57.27 -176.32 52 12 LYS A 209 ? ? 53.92 19.31 53 12 ASP A 211 ? ? -77.61 47.40 54 13 ALA A 106 ? ? -82.15 39.61 55 13 GLU A 107 ? ? 61.81 160.46 56 13 ASN A 121 ? ? -79.92 41.61 57 13 TYR A 176 ? ? -153.19 52.40 58 13 SER A 177 ? ? -68.62 -166.45 59 13 LYS A 203 ? ? -147.23 29.95 60 14 ASP A 112 ? ? -144.60 -18.28 61 14 ASN A 121 ? ? -79.63 46.87 62 14 LYS A 148 ? ? -145.18 58.30 63 14 TYR A 176 ? ? -152.82 66.24 64 14 SER A 177 ? ? -63.05 -174.57 65 14 VAL A 202 ? ? 50.88 77.58 66 15 ASN A 121 ? ? -80.33 49.16 67 15 LYS A 148 ? ? -145.32 58.68 68 15 TYR A 176 ? ? -150.81 46.45 69 15 LYS A 203 ? ? -77.94 31.05 70 15 LYS A 207 ? ? -139.62 -79.05 71 15 ARG A 208 ? ? -147.25 -54.47 72 15 ASP A 211 ? ? 59.80 14.61 73 16 CYS A 128 ? ? -140.91 -0.04 74 16 ARG A 208 ? ? -76.98 49.15 75 17 ASP A 112 ? ? -141.09 -24.44 76 17 CYS A 128 ? ? -141.78 -1.98 77 17 LYS A 148 ? ? -140.10 59.84 78 17 TYR A 176 ? ? -144.30 56.05 79 17 SER A 177 ? ? -68.40 -166.40 80 17 VAL A 202 ? ? -35.31 142.52 81 17 LYS A 203 ? ? -74.73 47.54 82 18 ALA A 106 ? ? -140.56 28.69 83 18 ASN A 121 ? ? -79.12 41.20 84 18 LYS A 148 ? ? -141.73 56.11 85 18 SER A 177 ? ? -58.93 -170.04 86 18 VAL A 202 ? ? 59.41 146.24 87 18 LYS A 203 ? ? -82.46 39.94 88 18 ARG A 208 ? ? 62.52 146.73 89 18 GLU A 212 ? ? -79.79 36.18 90 19 LYS A 105 ? ? -92.58 40.94 91 19 LYS A 148 ? ? -141.88 56.26 92 19 TYR A 176 ? ? -148.19 57.07 93 19 SER A 177 ? ? -64.63 -179.46 94 19 LEU A 199 ? ? -151.27 79.86 95 20 SER A 104 ? ? -81.17 38.41 96 20 LYS A 148 ? ? -145.35 56.88 97 20 TYR A 176 ? ? -144.08 59.97 98 20 SER A 177 ? ? -76.84 -165.14 99 20 GLU A 205 ? ? 57.03 9.77 100 20 ASP A 211 ? ? -80.67 41.44 101 21 ASP A 112 ? ? -146.53 -23.60 102 21 ASN A 121 ? ? -81.76 40.21 103 21 LYS A 148 ? ? -143.12 57.25 104 21 TYR A 176 ? ? -151.59 57.26 105 21 SER A 177 ? ? -68.64 -166.26 106 21 LYS A 203 ? ? -105.17 67.71 107 21 ARG A 208 ? ? 63.65 -23.30 108 22 ASP A 112 ? ? -141.07 -13.84 109 22 ALA A 118 ? ? -66.84 99.61 110 22 LYS A 148 ? ? -143.19 59.66 111 22 SER A 177 ? ? -60.08 -176.01 112 22 ASP A 211 ? ? -141.17 36.39 113 23 LYS A 105 ? ? -82.19 45.87 114 23 ALA A 106 ? ? 59.08 135.78 115 23 LYS A 148 ? ? -140.13 56.40 116 23 SER A 177 ? ? -60.87 -176.40 117 23 SER A 204 ? ? 48.66 27.69 118 23 LYS A 207 ? ? -152.08 -47.22 119 23 ASP A 211 ? ? 65.98 -29.78 120 24 LYS A 148 ? ? -141.83 56.29 121 24 SER A 177 ? ? -73.11 -159.55 122 25 ALA A 106 ? ? -145.05 41.49 123 25 LYS A 148 ? ? -143.45 57.81 124 25 TYR A 176 ? ? -147.04 58.67 125 25 SER A 177 ? ? -59.25 -174.68 126 26 LYS A 108 ? ? 52.72 -105.60 127 27 ASN A 121 ? ? -84.41 37.58 128 27 SER A 177 ? ? -60.77 -172.41 129 27 LEU A 199 ? ? -148.21 59.82 130 27 LYS A 207 ? ? -150.46 -42.62 131 27 VAL A 213 ? ? -77.32 20.31 132 28 CYS A 128 ? ? -140.38 -3.74 133 28 SER A 177 ? ? -62.54 -179.54 134 29 ALA A 118 ? ? -67.34 96.15 135 29 LYS A 148 ? ? -140.57 56.63 136 29 TYR A 176 ? ? -151.04 59.85 137 29 SER A 177 ? ? -79.45 -163.50 138 29 VAL A 213 ? ? 54.05 71.06 139 30 LYS A 148 ? ? -142.91 58.29 140 30 TYR A 176 ? ? -153.24 59.10 141 30 SER A 177 ? ? -72.03 -169.74 142 30 VAL A 202 ? ? 63.16 144.11 143 30 GLU A 205 ? ? -153.15 -55.70 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 4 GLU A 116 ? ? TYR A 117 ? ? 147.29 2 5 LEU A 151 ? ? GLY A 152 ? ? -149.25 3 11 LEU A 151 ? ? GLY A 152 ? ? -149.60 4 14 LEU A 151 ? ? GLY A 152 ? ? -149.52 5 15 GLU A 116 ? ? TYR A 117 ? ? 145.76 6 15 LEU A 151 ? ? GLY A 152 ? ? -149.22 7 19 LEU A 151 ? ? GLY A 152 ? ? -149.54 8 21 LEU A 151 ? ? GLY A 152 ? ? -149.46 9 22 LEU A 151 ? ? GLY A 152 ? ? -149.84 10 25 SER A 140 ? ? LYS A 141 ? ? 141.27 11 30 SER A 140 ? ? LYS A 141 ? ? 143.83 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 8 ARG A 156 ? ? 0.090 'SIDE CHAIN' 2 14 ARG A 208 ? ? 0.078 'SIDE CHAIN' 3 19 ARG A 167 ? ? 0.104 'SIDE CHAIN' 4 22 ARG A 156 ? ? 0.094 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L31 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L31 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '50 mM [U-99% 2H] TRIS-1, 200 mM sodium chloride-2, 150 uM zinc sulfate-3, 4 mM [U-99% 2H] DTT-4, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TRIS-1 50 ? mM '[U-99% 2H]' 1 'sodium chloride-2' 200 ? mM ? 1 'zinc sulfate-3' 150 ? uM ? 1 DTT-4 4 ? mM '[U-99% 2H]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.201 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC aliphatic' 1 3 1 '2D 1H-13C HSQC aromatic' 1 4 1 '2D 1H-1H NOESY' 1 5 1 '2D 1H-1H NOESY 15N-filtered' 1 6 1 '3D CBCAHN' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '3D HBHAHN' 1 9 1 '3D HBHA(CO)NH' 1 10 1 '3D [1H-13C-1H] HCCH-TOCSY' 1 11 1 '3D [13C-13C-1H] HCCH-TOCSY' 1 12 1 '3D 1H-15N NOESY' 1 13 1 '3D 1H-13C NOESY aliphatic' 1 14 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2L31 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Herrmann, Guntert and Wuthrich' 'structure solution' ATNOSCANDID ? 1 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 2 ? refinement Amber ? 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker DMX 2 'Bruker DMX' 500 Bruker DRX 3 'Bruker DRX' # _atom_sites.entry_id 2L31 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ #