data_2L3M # _entry.id 2L3M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L3M RCSB RCSB101914 WWPDB D_1000101914 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id IDP01108 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L3M _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-09-16 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, Y.' 1 'Winsor, J.' 2 'Dubrovska, I.' 3 'Anderson, W.' 4 'Radhakrishnan, I.' 5 'Center for Structural Genomics of Infectious Diseases (CSGID)' 6 # _citation.id primary _citation.title 'To be published' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Zhang, Y.' 1 primary 'Winsor, J.' 2 primary 'Dubrovska, I.' 3 primary 'Anderson, W.' 4 primary 'Radhakrishnan, I.' 5 primary 'Center for Structural Genomics of Infectious Diseases (CSGID)' 6 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Copper-ion-binding protein' _entity.formula_weight 7583.466 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SNAMEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ _entity_poly.pdbx_seq_one_letter_code_can SNAMEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier IDP01108 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 GLU n 1 6 GLN n 1 7 LEU n 1 8 THR n 1 9 LEU n 1 10 GLN n 1 11 VAL n 1 12 GLU n 1 13 GLY n 1 14 MET n 1 15 SER n 1 16 CYS n 1 17 GLY n 1 18 HIS n 1 19 CYS n 1 20 VAL n 1 21 ASN n 1 22 ALA n 1 23 ILE n 1 24 GLU n 1 25 SER n 1 26 SER n 1 27 VAL n 1 28 LYS n 1 29 GLU n 1 30 LEU n 1 31 ASN n 1 32 GLY n 1 33 VAL n 1 34 GLU n 1 35 GLN n 1 36 VAL n 1 37 LYS n 1 38 VAL n 1 39 GLN n 1 40 LEU n 1 41 ALA n 1 42 GLU n 1 43 GLY n 1 44 THR n 1 45 VAL n 1 46 GLU n 1 47 VAL n 1 48 THR n 1 49 ILE n 1 50 ASP n 1 51 SER n 1 52 SER n 1 53 VAL n 1 54 VAL n 1 55 THR n 1 56 LEU n 1 57 LYS n 1 58 ASP n 1 59 ILE n 1 60 VAL n 1 61 ALA n 1 62 VAL n 1 63 ILE n 1 64 GLU n 1 65 ASP n 1 66 GLN n 1 67 GLY n 1 68 TYR n 1 69 ASP n 1 70 VAL n 1 71 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'anthrax,anthrax bacterium' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BAS3576, BA_3860, GBAA3860, GBAA_3860' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Ames _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus anthracis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 198094 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pMCSG7 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q81WV5_BACAN _struct_ref.pdbx_db_accession Q81WV5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L3M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q81WV5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 68 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L3M SER A 1 ? UNP Q81WV5 ? ? 'EXPRESSION TAG' 1 1 1 2L3M ASN A 2 ? UNP Q81WV5 ? ? 'EXPRESSION TAG' 2 2 1 2L3M ALA A 3 ? UNP Q81WV5 ? ? 'EXPRESSION TAG' 3 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D 1H-15N NOESY' 1 5 2 '3D HCCH-TOCSY' 1 6 2 '3D 1H-13C NOESY' 1 7 2 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;20 mM potassium phosphate, 100 mM sodium chloride, 1 mM beta-mercaptoethanol, 1 mM EDTA, trace mM Protease Inhibitors, 1 mM sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;20 mM potassium phosphate, 100 mM sodium chloride, 1 mM beta-mercaptoethanol, 1 mM EDTA, trace mM Protease Inhibitors, 1 mM sodium azide, 100% D2O ; 2 '100% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L3M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L3M _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L3M _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 3 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 4 Goddard 'data analysis' SPARKY ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L3M _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L3M _struct.title 'Solution structure of the putative copper-ion-binding protein from Bacillus anthracis str. Ames' _struct.pdbx_descriptor 'Copper-ion-binding protein' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L3M _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, METAL BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 16 ? GLU A 29 ? CYS A 16 GLU A 29 1 ? 14 HELX_P HELX_P2 2 THR A 55 ? GLN A 66 ? THR A 55 GLN A 66 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 33 ? GLN A 39 ? VAL A 33 GLN A 39 A 2 THR A 44 ? ASP A 50 ? THR A 44 ASP A 50 A 3 MET A 4 ? GLU A 12 ? MET A 4 GLU A 12 A 4 ASP A 69 ? GLN A 71 ? ASP A 69 GLN A 71 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLN A 39 ? N GLN A 39 O THR A 44 ? O THR A 44 A 2 3 O VAL A 47 ? O VAL A 47 N LEU A 7 ? N LEU A 7 A 3 4 N GLU A 12 ? N GLU A 12 O ASP A 69 ? O ASP A 69 # _atom_sites.entry_id 2L3M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLN 71 71 71 GLN GLN A . n # _pdbx_SG_project.full_name_of_center 'Center for Structural Genomics of Infectious Diseases' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center CSGID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-12 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 20 ? mM ? 1 'sodium chloride-2' 100 ? mM ? 1 beta-mercaptoethanol-3 1 ? mM ? 1 EDTA-4 1 ? mM ? 1 'Protease Inhibitors-5' . ? mM ? 1 'sodium azide-6' 1 ? mM ? 1 'potassium phosphate-7' 20 ? mM ? 2 'sodium chloride-8' 100 ? mM ? 2 beta-mercaptoethanol-9 1 ? mM ? 2 EDTA-10 1 ? mM ? 2 'Protease Inhibitors-11' . ? mM ? 2 'sodium azide-12' 1 ? mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HG3 A GLU 34 ? ? HG3 A GLN 35 ? ? 1.35 2 2 HG1 A THR 55 ? ? OD2 A ASP 58 ? ? 1.58 3 5 H2 A SER 1 ? ? OD2 A ASP 50 ? ? 1.55 4 5 HG1 A THR 55 ? ? OD2 A ASP 58 ? ? 1.60 5 6 HG1 A THR 55 ? ? OD2 A ASP 58 ? ? 1.60 6 7 O A CYS 16 ? ? HG A CYS 19 ? ? 1.54 7 9 HZ2 A LYS 37 ? ? OE1 A GLU 46 ? ? 1.57 8 15 O A CYS 16 ? ? HG A CYS 19 ? ? 1.56 9 15 HG1 A THR 55 ? ? OD2 A ASP 58 ? ? 1.59 10 17 H3 A SER 1 ? ? OD2 A ASP 50 ? ? 1.60 11 18 HB2 A GLU 12 ? ? HB3 A ASP 69 ? ? 1.32 12 19 HG1 A THR 55 ? ? OD2 A ASP 58 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 34 ? ? -91.56 -68.73 2 1 VAL A 53 ? ? -131.48 -62.40 3 2 MET A 14 ? ? 61.49 178.29 4 2 SER A 15 ? ? -174.34 -52.59 5 2 VAL A 53 ? ? -121.19 -63.70 6 3 SER A 15 ? ? -102.28 -76.85 7 3 VAL A 53 ? ? -123.31 -54.38 8 4 SER A 15 ? ? -125.60 -81.70 9 4 CYS A 16 ? ? -167.82 -74.23 10 4 GLU A 34 ? ? -90.93 -67.99 11 4 VAL A 53 ? ? -125.58 -70.39 12 5 CYS A 16 ? ? 70.02 139.69 13 5 VAL A 53 ? ? -122.52 -51.54 14 6 ALA A 3 ? ? -164.32 102.16 15 6 CYS A 16 ? ? -164.38 -81.81 16 7 SER A 15 ? ? -147.53 -72.64 17 7 GLU A 34 ? ? -99.47 -69.69 18 7 VAL A 53 ? ? -120.70 -64.41 19 8 SER A 15 ? ? -82.08 -74.99 20 8 CYS A 16 ? ? -160.63 -90.32 21 9 ALA A 3 ? ? 60.56 82.57 22 9 MET A 14 ? ? 62.54 -170.39 23 9 SER A 15 ? ? -158.66 -73.97 24 9 CYS A 16 ? ? -153.83 -56.41 25 10 ASN A 2 ? ? 60.04 82.48 26 10 CYS A 16 ? ? 72.33 164.78 27 10 GLU A 34 ? ? -101.59 -69.14 28 10 VAL A 53 ? ? -125.39 -64.23 29 11 SER A 15 ? ? -93.29 -77.29 30 11 VAL A 53 ? ? -127.15 -66.13 31 12 SER A 15 ? ? -88.47 -86.25 32 12 CYS A 16 ? ? -149.52 -74.38 33 12 VAL A 53 ? ? -126.95 -61.65 34 13 VAL A 53 ? ? -121.69 -69.53 35 15 ASN A 2 ? ? 53.12 -92.85 36 15 SER A 15 ? ? -124.86 -73.21 37 15 GLU A 34 ? ? -91.16 -63.39 38 15 VAL A 53 ? ? -122.21 -64.93 39 16 CYS A 16 ? ? 55.63 -117.49 40 16 VAL A 53 ? ? -127.40 -64.05 41 17 MET A 14 ? ? 61.15 -176.05 42 17 SER A 15 ? ? -151.01 -73.84 43 17 CYS A 16 ? ? -152.66 -74.36 44 17 VAL A 53 ? ? -128.49 -58.28 45 18 MET A 14 ? ? -97.80 -85.93 46 18 SER A 15 ? ? 67.63 -75.31 47 18 VAL A 53 ? ? -125.41 -65.93 48 19 ASN A 2 ? ? 71.30 132.71 49 19 VAL A 36 ? ? -164.30 117.32 50 20 SER A 15 ? ? -147.66 -1.04 51 20 VAL A 53 ? ? -120.90 -67.72 #