data_2L3V # _entry.id 2L3V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.280 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L3V RCSB RCSB101923 WWPDB D_1000101923 # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2015-07-22 _pdbx_database_PDB_obs_spr.pdb_id 2N57 _pdbx_database_PDB_obs_spr.replace_pdb_id 2L3V _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id BrabA.00026.a _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L3V _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-09-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_mr OBS _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barnwal, R.' 1 'Varani, G.' 2 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 3 # _citation.id primary _citation.title 'NMR structure of Acyl carrier protein from Brucella melitensis' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Barnwal, R.' 1 primary 'Varani, G.' 2 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Acyl carrier protein' _entity.formula_weight 8395.275 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ACP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SMSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA _entity_poly.pdbx_seq_one_letter_code_can SMSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BrabA.00026.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 SER n 1 4 ASP n 1 5 THR n 1 6 ALA n 1 7 GLU n 1 8 ARG n 1 9 VAL n 1 10 LYS n 1 11 LYS n 1 12 ILE n 1 13 VAL n 1 14 VAL n 1 15 GLU n 1 16 HIS n 1 17 LEU n 1 18 GLY n 1 19 VAL n 1 20 ASP n 1 21 ALA n 1 22 ASP n 1 23 LYS n 1 24 VAL n 1 25 THR n 1 26 GLU n 1 27 GLY n 1 28 ALA n 1 29 SER n 1 30 PHE n 1 31 ILE n 1 32 ASP n 1 33 ASP n 1 34 LEU n 1 35 GLY n 1 36 ALA n 1 37 ASP n 1 38 SER n 1 39 LEU n 1 40 ASP n 1 41 THR n 1 42 VAL n 1 43 GLU n 1 44 LEU n 1 45 VAL n 1 46 MET n 1 47 ALA n 1 48 PHE n 1 49 GLU n 1 50 GLU n 1 51 GLU n 1 52 PHE n 1 53 GLY n 1 54 VAL n 1 55 GLU n 1 56 ILE n 1 57 PRO n 1 58 ASP n 1 59 ASP n 1 60 ALA n 1 61 ALA n 1 62 GLU n 1 63 THR n 1 64 ILE n 1 65 LEU n 1 66 THR n 1 67 VAL n 1 68 GLY n 1 69 ASP n 1 70 ALA n 1 71 VAL n 1 72 LYS n 1 73 PHE n 1 74 ILE n 1 75 ASP n 1 76 LYS n 1 77 ALA n 1 78 SER n 1 79 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'acpP, BAOG_00187' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Brucella melitensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 520466 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code D1F788_BRUME _struct_ref.pdbx_db_accession D1F788 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAAETILTVGDAVKFIDKASA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L3V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession D1F788 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 78 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 79 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2L3V _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code D1F788 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'EXPRESSION TAG' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCACB' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-15N TOCSY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '3D HCCH-COSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 # _pdbx_nmr_sample_details.contents ;1.2-1.4 mM [U-98% 15N] acyl carrir protein, 1.2 mM [U-95% 13C; U-95% 15N] acyl carrir protein, 1.5 mM acyl carrir protein, 93% H2O/7% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 500 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L3V _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L3V _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L3V _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TOPSPIN 2.1 1 'Guntert, P. et al.' refinement Cyana 2.1 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L3V _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L3V _struct.title 'NMR structure of Acyl carrier protein from Brucella melitensis' _struct.pdbx_descriptor 'Acyl carrier protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L3V _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text ;Acyl carrier protein, Brucella melitensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, LIPID BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 3 ? LEU A 17 ? SER A 3 LEU A 17 1 ? 15 HELX_P HELX_P2 2 ALA A 47 ? PHE A 52 ? ALA A 47 PHE A 52 1 ? 6 HELX_P HELX_P3 3 PRO A 57 ? GLU A 62 ? PRO A 57 GLU A 62 1 ? 6 HELX_P HELX_P4 4 ALA A 70 ? ALA A 77 ? ALA A 70 ALA A 77 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2L3V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ALA 79 79 79 ALA ALA A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-10-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2015-07-22 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description 1 1 'Structure model' repository 'Initial release' ? 2 3 'Structure model' repository Obsolete ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'acyl carrir protein-1' ? 1.2-1.4 mM '[U-98% 15N]' 1 'acyl carrir protein-2' 1.2 ? mM '[U-95% 13C; U-95% 15N]' 1 'acyl carrir protein-3' 1.5 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 16 ? ? -77.58 -75.30 2 1 ASP A 20 ? ? -68.68 -164.02 3 1 LEU A 39 ? ? -104.52 -60.60 4 1 ASP A 40 ? ? -165.15 -70.74 5 1 VAL A 42 ? ? -151.32 -61.60 6 1 GLU A 43 ? ? 173.95 -52.73 7 1 PRO A 57 ? ? -69.78 -177.83 8 1 LEU A 65 ? ? 178.58 49.43 9 2 HIS A 16 ? ? -106.85 -75.79 10 2 ASP A 20 ? ? -61.21 -170.27 11 2 LEU A 39 ? ? -109.22 -61.98 12 2 ASP A 40 ? ? -163.68 -73.05 13 2 THR A 41 ? ? -120.26 -51.86 14 2 VAL A 42 ? ? -154.74 -62.80 15 2 GLU A 43 ? ? 179.95 -43.86 16 2 PRO A 57 ? ? -69.79 -178.01 17 2 LEU A 65 ? ? 178.09 35.77 18 3 HIS A 16 ? ? -76.89 -72.79 19 3 ASP A 20 ? ? -66.37 -163.45 20 3 LEU A 39 ? ? -106.00 -60.75 21 3 ASP A 40 ? ? -162.43 -69.27 22 3 THR A 41 ? ? -133.38 -43.86 23 3 VAL A 42 ? ? -153.24 -58.34 24 3 GLU A 43 ? ? 176.56 -62.62 25 3 PRO A 57 ? ? -69.82 -177.74 26 3 LEU A 65 ? ? 178.00 53.30 27 3 VAL A 67 ? ? 36.00 47.88 28 4 ASP A 20 ? ? -69.82 -162.73 29 4 ASP A 40 ? ? -159.42 -74.94 30 4 THR A 41 ? ? -122.46 -53.35 31 4 VAL A 42 ? ? -147.40 -65.45 32 4 GLU A 43 ? ? -179.14 -47.74 33 4 PRO A 57 ? ? -69.78 -177.71 34 4 LEU A 65 ? ? 179.24 34.74 35 5 MET A 2 ? ? -174.67 124.22 36 5 ASP A 20 ? ? -68.87 -162.97 37 5 LEU A 39 ? ? -96.16 -60.25 38 5 ASP A 40 ? ? -175.43 -75.27 39 5 VAL A 42 ? ? -152.73 -62.15 40 5 GLU A 43 ? ? 179.20 -46.74 41 5 LEU A 65 ? ? 178.47 54.36 42 5 VAL A 67 ? ? 35.99 53.12 43 6 HIS A 16 ? ? -76.84 -72.02 44 6 ASP A 20 ? ? -65.52 -163.73 45 6 ASP A 40 ? ? -162.36 -76.20 46 6 VAL A 42 ? ? -147.37 -60.49 47 6 GLU A 43 ? ? 176.96 -47.21 48 6 PRO A 57 ? ? -69.77 -177.88 49 6 LEU A 65 ? ? 178.05 49.46 50 6 VAL A 67 ? ? 36.36 48.07 51 7 ASP A 20 ? ? -67.21 -164.42 52 7 LEU A 39 ? ? -108.17 -60.34 53 7 ASP A 40 ? ? -164.04 -71.10 54 7 VAL A 42 ? ? -152.24 -59.05 55 7 GLU A 43 ? ? 179.02 -64.07 56 7 PRO A 57 ? ? -69.76 -177.76 57 7 LEU A 65 ? ? 178.91 57.47 58 7 VAL A 67 ? ? 37.21 45.38 59 8 HIS A 16 ? ? -76.24 -75.25 60 8 ASP A 20 ? ? -64.67 -165.19 61 8 ASP A 40 ? ? -158.52 -76.22 62 8 THR A 41 ? ? -120.99 -51.96 63 8 VAL A 42 ? ? -147.24 -63.48 64 8 GLU A 43 ? ? -179.51 -50.64 65 8 PRO A 57 ? ? -69.82 -177.95 66 8 LEU A 65 ? ? 178.93 50.09 67 9 ASP A 20 ? ? -75.28 -159.81 68 9 ASP A 40 ? ? -179.55 -79.01 69 9 THR A 41 ? ? -67.11 -73.56 70 9 VAL A 42 ? ? -153.93 -60.44 71 9 GLU A 43 ? ? 174.23 -58.08 72 9 PRO A 57 ? ? -69.79 -177.61 73 9 LEU A 65 ? ? -179.73 33.43 74 10 ASP A 20 ? ? -69.88 -162.02 75 10 ASP A 40 ? ? -168.64 -73.27 76 10 VAL A 42 ? ? -151.69 -64.01 77 10 GLU A 43 ? ? -178.10 -44.42 78 10 LEU A 65 ? ? -168.12 27.21 79 10 VAL A 67 ? ? -47.11 99.48 #