data_2L4B # _entry.id 2L4B # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L4B pdb_00002l4b 10.2210/pdb2l4b/pdb RCSB RCSB101939 ? ? WWPDB D_1000101939 ? ? BMRB 17235 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB AnphA.01018.a . unspecified BMRB 17235 . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L4B _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-10-02 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buchko, G.W.' 1 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 # _citation.id primary _citation.title ;Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buchko, G.W.' 1 ? primary 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Acyl carrier protein' _entity.formula_weight 9783.935 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PGSMVSEEIKAQVMESVIGCLKLNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRY IASKSSDA ; _entity_poly.pdbx_seq_one_letter_code_can ;PGSMVSEEIKAQVMESVIGCLKLNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRY IASKSSDA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier AnphA.01018.a # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLY n 1 3 SER n 1 4 MET n 1 5 VAL n 1 6 SER n 1 7 GLU n 1 8 GLU n 1 9 ILE n 1 10 LYS n 1 11 ALA n 1 12 GLN n 1 13 VAL n 1 14 MET n 1 15 GLU n 1 16 SER n 1 17 VAL n 1 18 ILE n 1 19 GLY n 1 20 CYS n 1 21 LEU n 1 22 LYS n 1 23 LEU n 1 24 ASN n 1 25 ASP n 1 26 GLU n 1 27 GLN n 1 28 LYS n 1 29 GLN n 1 30 ILE n 1 31 LEU n 1 32 SER n 1 33 GLY n 1 34 THR n 1 35 THR n 1 36 ASN n 1 37 LEU n 1 38 ALA n 1 39 LYS n 1 40 ASP n 1 41 PHE n 1 42 ASN n 1 43 LEU n 1 44 ASP n 1 45 SER n 1 46 LEU n 1 47 ASP n 1 48 PHE n 1 49 VAL n 1 50 ASP n 1 51 LEU n 1 52 ILE n 1 53 MET n 1 54 SER n 1 55 LEU n 1 56 GLU n 1 57 GLU n 1 58 ARG n 1 59 PHE n 1 60 SER n 1 61 LEU n 1 62 GLU n 1 63 ILE n 1 64 SER n 1 65 ASP n 1 66 GLU n 1 67 ASP n 1 68 ALA n 1 69 GLN n 1 70 LYS n 1 71 LEU n 1 72 GLU n 1 73 THR n 1 74 VAL n 1 75 ASP n 1 76 ASP n 1 77 ILE n 1 78 CYS n 1 79 ARG n 1 80 TYR n 1 81 ILE n 1 82 ALA n 1 83 SER n 1 84 LYS n 1 85 SER n 1 86 SER n 1 87 ASP n 1 88 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene APH_0929 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain HZ _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anaplasma phagocytophilum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 212042 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name AVA0421 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q2GJE9_ANAPZ _struct_ref.pdbx_db_accession Q2GJE9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SEEIKAQVMESVIGCLKLNDEQKQILSGTTNLAKDFNLDSLDFVDLIMSLEERFSLEISDEDAQKLETVDDICRYIASKS SDA ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L4B _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 88 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q2GJE9 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 88 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L4B PRO A 1 ? UNP Q2GJE9 ? ? 'expression tag' 1 1 1 2L4B GLY A 2 ? UNP Q2GJE9 ? ? 'expression tag' 2 2 1 2L4B SER A 3 ? UNP Q2GJE9 ? ? 'expression tag' 3 3 1 2L4B MET A 4 ? UNP Q2GJE9 ? ? 'expression tag' 4 4 1 2L4B VAL A 5 ? UNP Q2GJE9 ? ? 'expression tag' 5 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCACB' 1 4 1 '3D HN(COCA)CB' 1 5 1 '3D C(CO)NH' 1 6 1 '3D HNCO' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 2 'deuterium exchange' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1-2 mM [U-100% 13C; U-100% 15N] ACP18, 100 mM sodium chloride, 20 mM TRIS, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '1-2 mM [U-98% 15N] ACP18, 100 mM sodium chloride, 20 mM TRIS, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L4B _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L4B _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L4B _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Accelrys Software Inc.' processing Felix 2007 2 Goddard 'data analysis' Sparky 3.115 3 Goddard 'peak picking' Sparky 3.115 4 'Bhattacharya and Montelione' 'data analysis' PSVS 1.1 5 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 6 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L4B _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L4B _struct.title ;Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a ; _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L4B _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;infectious disease, Human granulocytic anaplasmosis, SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 6 ? LYS A 22 ? SER A 6 LYS A 22 1 ? 17 HELX_P HELX_P2 2 ASN A 24 ? ILE A 30 ? ASN A 24 ILE A 30 1 ? 7 HELX_P HELX_P3 3 ASP A 44 ? PHE A 59 ? ASP A 44 PHE A 59 1 ? 16 HELX_P HELX_P4 4 SER A 64 ? LYS A 70 ? SER A 64 LYS A 70 1 ? 7 HELX_P HELX_P5 5 THR A 73 ? SER A 85 ? THR A 73 SER A 85 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2L4B _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 MET 53 53 53 MET MET A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ALA 88 88 88 ALA ALA A . n # _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center SSGCID _pdbx_SG_project.project_name ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id ACP18-1 ? 1-2 mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride-2' 100 ? mM ? 1 TRIS-3 20 ? mM ? 1 ACP18-4 ? 1-2 mM '[U-98% 15N]' 2 'sodium chloride-5' 100 ? mM ? 2 TRIS-6 20 ? mM ? 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? -63.42 93.91 2 1 LYS A 22 ? ? 50.15 88.67 3 1 THR A 34 ? ? -99.59 39.00 4 1 ASN A 36 ? ? -53.67 104.10 5 2 LYS A 22 ? ? 51.06 90.21 6 2 ASN A 36 ? ? -54.15 103.00 7 3 SER A 6 ? ? -67.09 89.57 8 3 LYS A 22 ? ? 50.88 89.92 9 3 ASN A 36 ? ? -57.31 105.95 10 4 SER A 6 ? ? -63.82 93.51 11 4 LYS A 22 ? ? 50.12 89.28 12 4 ASN A 36 ? ? -53.66 103.71 13 4 GLU A 72 ? ? -137.43 -42.03 14 5 SER A 6 ? ? -65.12 91.82 15 5 LYS A 22 ? ? 51.80 91.17 16 5 THR A 34 ? ? -93.95 39.01 17 5 ASN A 36 ? ? -53.58 105.01 18 5 SER A 85 ? ? -104.66 56.19 19 6 SER A 6 ? ? -64.63 93.26 20 6 LYS A 22 ? ? 52.91 92.47 21 6 THR A 34 ? ? -98.14 38.82 22 6 ASN A 36 ? ? -54.12 104.66 23 6 GLU A 72 ? ? -139.87 -46.31 24 7 LYS A 22 ? ? 50.05 89.01 25 7 ASN A 36 ? ? -59.82 106.00 26 8 SER A 6 ? ? -51.25 103.62 27 8 LYS A 22 ? ? 51.25 90.36 28 8 THR A 34 ? ? -98.19 39.01 29 8 ASN A 36 ? ? -55.85 105.60 30 9 SER A 3 ? ? -54.18 105.62 31 9 LYS A 22 ? ? 50.18 89.19 32 9 THR A 34 ? ? -99.60 38.89 33 9 ASN A 36 ? ? -53.80 104.22 34 10 LYS A 22 ? ? 52.01 91.69 35 10 ASN A 36 ? ? -55.35 104.00 36 11 SER A 3 ? ? -171.78 136.01 37 11 LYS A 22 ? ? 52.79 92.23 38 11 ASN A 36 ? ? -55.48 105.30 39 12 LYS A 22 ? ? 51.87 91.75 40 12 THR A 34 ? ? -97.71 38.16 41 12 ASN A 36 ? ? -53.72 105.06 42 13 LYS A 22 ? ? 51.61 90.82 43 13 THR A 34 ? ? -96.65 39.05 44 13 ASN A 36 ? ? -54.20 105.79 45 14 VAL A 5 ? ? -59.01 -177.96 46 14 SER A 6 ? ? -61.66 95.68 47 14 LYS A 22 ? ? 50.41 89.20 48 14 THR A 34 ? ? -94.19 38.18 49 14 ASN A 36 ? ? -53.39 105.41 50 14 GLU A 72 ? ? -137.60 -48.95 51 14 SER A 85 ? ? -93.23 43.13 52 15 LYS A 22 ? ? 51.01 90.41 53 15 SER A 85 ? ? -60.96 -73.46 54 15 SER A 86 ? ? -56.64 -74.02 55 16 LYS A 22 ? ? 50.91 89.89 56 16 THR A 34 ? ? -94.65 38.90 57 16 GLU A 72 ? ? -137.07 -41.91 58 17 SER A 3 ? ? -58.30 170.65 59 17 LYS A 22 ? ? 49.62 89.18 60 17 THR A 34 ? ? -95.15 38.99 61 17 ASN A 36 ? ? -54.62 103.70 62 17 SER A 85 ? ? -112.66 61.60 63 18 SER A 3 ? ? -164.76 110.27 64 18 VAL A 5 ? ? -53.52 173.10 65 18 SER A 6 ? ? -53.73 107.59 66 18 LYS A 22 ? ? 50.46 88.62 67 18 SER A 32 ? ? -171.77 145.74 68 18 THR A 34 ? ? -94.22 39.06 69 18 ASN A 36 ? ? -53.46 105.96 70 18 ASP A 87 ? ? -111.00 77.43 71 19 SER A 6 ? ? -63.01 96.09 72 19 LYS A 22 ? ? 49.91 88.06 73 19 THR A 34 ? ? -95.43 39.04 74 19 ASN A 36 ? ? -55.86 103.16 75 20 SER A 3 ? ? -113.95 68.72 76 20 LYS A 22 ? ? 49.43 88.13 77 20 THR A 34 ? ? -95.62 38.84 78 20 ASN A 36 ? ? -53.80 105.22 79 20 GLU A 72 ? ? -145.38 -47.34 #