data_2L4I # _entry.id 2L4I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L4I pdb_00002l4i 10.2210/pdb2l4i/pdb RCSB RCSB101946 ? ? WWPDB D_1000101946 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-03-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' pdbx_struct_conn_angle 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_ref_seq_dif 9 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.value' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 3 'Structure model' '_struct_ref_seq_dif.details' 23 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 24 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 25 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L4I _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-10-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1XO5 PDB 'crystal structure of Ca-CIB1' unspecified 2L4H PDB 'solution structure of Ca-CIB1' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Huang, H.' 1 'Vogel, H.J.' 2 # _citation.id primary _citation.title 'Solution Structures of Ca2+-CIB1 and Mg2+-CIB1 and Their Interactions with the Platelet Integrin {alpha}IIb Cytoplasmic Domain.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 17181 _citation.page_last 17192 _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21388953 _citation.pdbx_database_id_DOI 10.1074/jbc.M110.179028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Huang, H.' 1 ? primary 'Ishida, H.' 2 ? primary 'Yamniuk, A.P.' 3 ? primary 'Vogel, H.J.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium and integrin-binding protein 1' 24507.264 1 ? ? ? ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;CIB, Calcium- and integrin-binding protein, CIBP, Calmyrin, DNA-PKcs-interacting protein, Kinase-interacting protein, KIP, SNK-interacting protein 2-28, SIP2-28 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHHHHHSSGHIDDDDKHMGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQ ILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTG EGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHHHHHSSGHIDDDDKHMGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQ ILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTG EGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'MAGNESIUM ION' _pdbx_entity_nonpoly.comp_id MG # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 HIS n 1 17 ILE n 1 18 ASP n 1 19 ASP n 1 20 ASP n 1 21 ASP n 1 22 LYS n 1 23 HIS n 1 24 MET n 1 25 GLY n 1 26 GLY n 1 27 SER n 1 28 GLY n 1 29 SER n 1 30 ARG n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 GLU n 1 35 LEU n 1 36 LEU n 1 37 ALA n 1 38 GLU n 1 39 TYR n 1 40 GLN n 1 41 ASP n 1 42 LEU n 1 43 THR n 1 44 PHE n 1 45 LEU n 1 46 THR n 1 47 LYS n 1 48 GLN n 1 49 GLU n 1 50 ILE n 1 51 LEU n 1 52 LEU n 1 53 ALA n 1 54 HIS n 1 55 ARG n 1 56 ARG n 1 57 PHE n 1 58 CYS n 1 59 GLU n 1 60 LEU n 1 61 LEU n 1 62 PRO n 1 63 GLN n 1 64 GLU n 1 65 GLN n 1 66 ARG n 1 67 SER n 1 68 VAL n 1 69 GLU n 1 70 SER n 1 71 SER n 1 72 LEU n 1 73 ARG n 1 74 ALA n 1 75 GLN n 1 76 VAL n 1 77 PRO n 1 78 PHE n 1 79 GLU n 1 80 GLN n 1 81 ILE n 1 82 LEU n 1 83 SER n 1 84 LEU n 1 85 PRO n 1 86 GLU n 1 87 LEU n 1 88 LYS n 1 89 ALA n 1 90 ASN n 1 91 PRO n 1 92 PHE n 1 93 LYS n 1 94 GLU n 1 95 ARG n 1 96 ILE n 1 97 CYS n 1 98 ARG n 1 99 VAL n 1 100 PHE n 1 101 SER n 1 102 THR n 1 103 SER n 1 104 PRO n 1 105 ALA n 1 106 LYS n 1 107 ASP n 1 108 SER n 1 109 LEU n 1 110 SER n 1 111 PHE n 1 112 GLU n 1 113 ASP n 1 114 PHE n 1 115 LEU n 1 116 ASP n 1 117 LEU n 1 118 LEU n 1 119 SER n 1 120 VAL n 1 121 PHE n 1 122 SER n 1 123 ASP n 1 124 THR n 1 125 ALA n 1 126 THR n 1 127 PRO n 1 128 ASP n 1 129 ILE n 1 130 LYS n 1 131 SER n 1 132 HIS n 1 133 TYR n 1 134 ALA n 1 135 PHE n 1 136 ARG n 1 137 ILE n 1 138 PHE n 1 139 ASP n 1 140 PHE n 1 141 ASP n 1 142 ASP n 1 143 ASP n 1 144 GLY n 1 145 THR n 1 146 LEU n 1 147 ASN n 1 148 ARG n 1 149 GLU n 1 150 ASP n 1 151 LEU n 1 152 SER n 1 153 ARG n 1 154 LEU n 1 155 VAL n 1 156 ASN n 1 157 CYS n 1 158 LEU n 1 159 THR n 1 160 GLY n 1 161 GLU n 1 162 GLY n 1 163 GLU n 1 164 ASP n 1 165 THR n 1 166 ARG n 1 167 LEU n 1 168 SER n 1 169 ALA n 1 170 SER n 1 171 GLU n 1 172 MET n 1 173 LYS n 1 174 GLN n 1 175 LEU n 1 176 ILE n 1 177 ASP n 1 178 ASN n 1 179 ILE n 1 180 LEU n 1 181 GLU n 1 182 GLU n 1 183 SER n 1 184 ASP n 1 185 ILE n 1 186 ASP n 1 187 ARG n 1 188 ASP n 1 189 GLY n 1 190 THR n 1 191 ILE n 1 192 ASN n 1 193 LEU n 1 194 SER n 1 195 GLU n 1 196 PHE n 1 197 GLN n 1 198 HIS n 1 199 VAL n 1 200 ILE n 1 201 SER n 1 202 ARG n 1 203 SER n 1 204 PRO n 1 205 ASP n 1 206 PHE n 1 207 ALA n 1 208 SER n 1 209 SER n 1 210 PHE n 1 211 LYS n 1 212 ILE n 1 213 VAL n 1 214 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CIB1, CIB, KIP, PRKDCIP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET19b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -22 ? ? ? A . n A 1 2 GLY 2 -21 ? ? ? A . n A 1 3 HIS 3 -20 ? ? ? A . n A 1 4 HIS 4 -19 ? ? ? A . n A 1 5 HIS 5 -18 ? ? ? A . n A 1 6 HIS 6 -17 ? ? ? A . n A 1 7 HIS 7 -16 ? ? ? A . n A 1 8 HIS 8 -15 ? ? ? A . n A 1 9 HIS 9 -14 ? ? ? A . n A 1 10 HIS 10 -13 ? ? ? A . n A 1 11 HIS 11 -12 ? ? ? A . n A 1 12 HIS 12 -11 ? ? ? A . n A 1 13 SER 13 -10 ? ? ? A . n A 1 14 SER 14 -9 ? ? ? A . n A 1 15 GLY 15 -8 ? ? ? A . n A 1 16 HIS 16 -7 ? ? ? A . n A 1 17 ILE 17 -6 ? ? ? A . n A 1 18 ASP 18 -5 ? ? ? A . n A 1 19 ASP 19 -4 ? ? ? A . n A 1 20 ASP 20 -3 ? ? ? A . n A 1 21 ASP 21 -2 ? ? ? A . n A 1 22 LYS 22 -1 ? ? ? A . n A 1 23 HIS 23 0 ? ? ? A . n A 1 24 MET 24 1 ? ? ? A . n A 1 25 GLY 25 2 ? ? ? A . n A 1 26 GLY 26 3 ? ? ? A . n A 1 27 SER 27 4 ? ? ? A . n A 1 28 GLY 28 5 ? ? ? A . n A 1 29 SER 29 6 ? ? ? A . n A 1 30 ARG 30 7 ? ? ? A . n A 1 31 LEU 31 8 8 LEU LEU A . n A 1 32 SER 32 9 9 SER SER A . n A 1 33 LYS 33 10 10 LYS LYS A . n A 1 34 GLU 34 11 11 GLU GLU A . n A 1 35 LEU 35 12 12 LEU LEU A . n A 1 36 LEU 36 13 13 LEU LEU A . n A 1 37 ALA 37 14 14 ALA ALA A . n A 1 38 GLU 38 15 15 GLU GLU A . n A 1 39 TYR 39 16 16 TYR TYR A . n A 1 40 GLN 40 17 17 GLN GLN A . n A 1 41 ASP 41 18 18 ASP ASP A . n A 1 42 LEU 42 19 19 LEU LEU A . n A 1 43 THR 43 20 20 THR THR A . n A 1 44 PHE 44 21 21 PHE PHE A . n A 1 45 LEU 45 22 22 LEU LEU A . n A 1 46 THR 46 23 23 THR THR A . n A 1 47 LYS 47 24 24 LYS LYS A . n A 1 48 GLN 48 25 25 GLN GLN A . n A 1 49 GLU 49 26 26 GLU GLU A . n A 1 50 ILE 50 27 27 ILE ILE A . n A 1 51 LEU 51 28 28 LEU LEU A . n A 1 52 LEU 52 29 29 LEU LEU A . n A 1 53 ALA 53 30 30 ALA ALA A . n A 1 54 HIS 54 31 31 HIS HIS A . n A 1 55 ARG 55 32 32 ARG ARG A . n A 1 56 ARG 56 33 33 ARG ARG A . n A 1 57 PHE 57 34 34 PHE PHE A . n A 1 58 CYS 58 35 35 CYS CYS A . n A 1 59 GLU 59 36 36 GLU GLU A . n A 1 60 LEU 60 37 37 LEU LEU A . n A 1 61 LEU 61 38 38 LEU LEU A . n A 1 62 PRO 62 39 39 PRO PRO A . n A 1 63 GLN 63 40 40 GLN GLN A . n A 1 64 GLU 64 41 41 GLU GLU A . n A 1 65 GLN 65 42 42 GLN GLN A . n A 1 66 ARG 66 43 43 ARG ARG A . n A 1 67 SER 67 44 44 SER SER A . n A 1 68 VAL 68 45 45 VAL VAL A . n A 1 69 GLU 69 46 46 GLU GLU A . n A 1 70 SER 70 47 47 SER SER A . n A 1 71 SER 71 48 48 SER SER A . n A 1 72 LEU 72 49 49 LEU LEU A . n A 1 73 ARG 73 50 50 ARG ARG A . n A 1 74 ALA 74 51 51 ALA ALA A . n A 1 75 GLN 75 52 52 GLN GLN A . n A 1 76 VAL 76 53 53 VAL VAL A . n A 1 77 PRO 77 54 54 PRO PRO A . n A 1 78 PHE 78 55 55 PHE PHE A . n A 1 79 GLU 79 56 56 GLU GLU A . n A 1 80 GLN 80 57 57 GLN GLN A . n A 1 81 ILE 81 58 58 ILE ILE A . n A 1 82 LEU 82 59 59 LEU LEU A . n A 1 83 SER 83 60 60 SER SER A . n A 1 84 LEU 84 61 61 LEU LEU A . n A 1 85 PRO 85 62 62 PRO PRO A . n A 1 86 GLU 86 63 63 GLU GLU A . n A 1 87 LEU 87 64 64 LEU LEU A . n A 1 88 LYS 88 65 65 LYS LYS A . n A 1 89 ALA 89 66 66 ALA ALA A . n A 1 90 ASN 90 67 67 ASN ASN A . n A 1 91 PRO 91 68 68 PRO PRO A . n A 1 92 PHE 92 69 69 PHE PHE A . n A 1 93 LYS 93 70 70 LYS LYS A . n A 1 94 GLU 94 71 71 GLU GLU A . n A 1 95 ARG 95 72 72 ARG ARG A . n A 1 96 ILE 96 73 73 ILE ILE A . n A 1 97 CYS 97 74 74 CYS CYS A . n A 1 98 ARG 98 75 75 ARG ARG A . n A 1 99 VAL 99 76 76 VAL VAL A . n A 1 100 PHE 100 77 77 PHE PHE A . n A 1 101 SER 101 78 78 SER SER A . n A 1 102 THR 102 79 79 THR THR A . n A 1 103 SER 103 80 80 SER SER A . n A 1 104 PRO 104 81 81 PRO PRO A . n A 1 105 ALA 105 82 82 ALA ALA A . n A 1 106 LYS 106 83 83 LYS LYS A . n A 1 107 ASP 107 84 84 ASP ASP A . n A 1 108 SER 108 85 85 SER SER A . n A 1 109 LEU 109 86 86 LEU LEU A . n A 1 110 SER 110 87 87 SER SER A . n A 1 111 PHE 111 88 88 PHE PHE A . n A 1 112 GLU 112 89 89 GLU GLU A . n A 1 113 ASP 113 90 90 ASP ASP A . n A 1 114 PHE 114 91 91 PHE PHE A . n A 1 115 LEU 115 92 92 LEU LEU A . n A 1 116 ASP 116 93 93 ASP ASP A . n A 1 117 LEU 117 94 94 LEU LEU A . n A 1 118 LEU 118 95 95 LEU LEU A . n A 1 119 SER 119 96 96 SER SER A . n A 1 120 VAL 120 97 97 VAL VAL A . n A 1 121 PHE 121 98 98 PHE PHE A . n A 1 122 SER 122 99 99 SER SER A . n A 1 123 ASP 123 100 100 ASP ASP A . n A 1 124 THR 124 101 101 THR THR A . n A 1 125 ALA 125 102 102 ALA ALA A . n A 1 126 THR 126 103 103 THR THR A . n A 1 127 PRO 127 104 104 PRO PRO A . n A 1 128 ASP 128 105 105 ASP ASP A . n A 1 129 ILE 129 106 106 ILE ILE A . n A 1 130 LYS 130 107 107 LYS LYS A . n A 1 131 SER 131 108 108 SER SER A . n A 1 132 HIS 132 109 109 HIS HIS A . n A 1 133 TYR 133 110 110 TYR TYR A . n A 1 134 ALA 134 111 111 ALA ALA A . n A 1 135 PHE 135 112 112 PHE PHE A . n A 1 136 ARG 136 113 113 ARG ARG A . n A 1 137 ILE 137 114 114 ILE ILE A . n A 1 138 PHE 138 115 115 PHE PHE A . n A 1 139 ASP 139 116 116 ASP ASP A . n A 1 140 PHE 140 117 117 PHE PHE A . n A 1 141 ASP 141 118 118 ASP ASP A . n A 1 142 ASP 142 119 119 ASP ASP A . n A 1 143 ASP 143 120 120 ASP ASP A . n A 1 144 GLY 144 121 121 GLY GLY A . n A 1 145 THR 145 122 122 THR THR A . n A 1 146 LEU 146 123 123 LEU LEU A . n A 1 147 ASN 147 124 124 ASN ASN A . n A 1 148 ARG 148 125 125 ARG ARG A . n A 1 149 GLU 149 126 126 GLU GLU A . n A 1 150 ASP 150 127 127 ASP ASP A . n A 1 151 LEU 151 128 128 LEU LEU A . n A 1 152 SER 152 129 129 SER SER A . n A 1 153 ARG 153 130 130 ARG ARG A . n A 1 154 LEU 154 131 131 LEU LEU A . n A 1 155 VAL 155 132 132 VAL VAL A . n A 1 156 ASN 156 133 133 ASN ASN A . n A 1 157 CYS 157 134 134 CYS CYS A . n A 1 158 LEU 158 135 135 LEU LEU A . n A 1 159 THR 159 136 136 THR THR A . n A 1 160 GLY 160 137 137 GLY GLY A . n A 1 161 GLU 161 138 138 GLU GLU A . n A 1 162 GLY 162 139 139 GLY GLY A . n A 1 163 GLU 163 140 140 GLU GLU A . n A 1 164 ASP 164 141 141 ASP ASP A . n A 1 165 THR 165 142 142 THR THR A . n A 1 166 ARG 166 143 143 ARG ARG A . n A 1 167 LEU 167 144 144 LEU LEU A . n A 1 168 SER 168 145 145 SER SER A . n A 1 169 ALA 169 146 146 ALA ALA A . n A 1 170 SER 170 147 147 SER SER A . n A 1 171 GLU 171 148 148 GLU GLU A . n A 1 172 MET 172 149 149 MET MET A . n A 1 173 LYS 173 150 150 LYS LYS A . n A 1 174 GLN 174 151 151 GLN GLN A . n A 1 175 LEU 175 152 152 LEU LEU A . n A 1 176 ILE 176 153 153 ILE ILE A . n A 1 177 ASP 177 154 154 ASP ASP A . n A 1 178 ASN 178 155 155 ASN ASN A . n A 1 179 ILE 179 156 156 ILE ILE A . n A 1 180 LEU 180 157 157 LEU LEU A . n A 1 181 GLU 181 158 ? ? ? A . n A 1 182 GLU 182 159 ? ? ? A . n A 1 183 SER 183 160 ? ? ? A . n A 1 184 ASP 184 161 ? ? ? A . n A 1 185 ILE 185 162 ? ? ? A . n A 1 186 ASP 186 163 ? ? ? A . n A 1 187 ARG 187 164 ? ? ? A . n A 1 188 ASP 188 165 ? ? ? A . n A 1 189 GLY 189 166 ? ? ? A . n A 1 190 THR 190 167 ? ? ? A . n A 1 191 ILE 191 168 ? ? ? A . n A 1 192 ASN 192 169 ? ? ? A . n A 1 193 LEU 193 170 ? ? ? A . n A 1 194 SER 194 171 ? ? ? A . n A 1 195 GLU 195 172 ? ? ? A . n A 1 196 PHE 196 173 ? ? ? A . n A 1 197 GLN 197 174 ? ? ? A . n A 1 198 HIS 198 175 ? ? ? A . n A 1 199 VAL 199 176 ? ? ? A . n A 1 200 ILE 200 177 ? ? ? A . n A 1 201 SER 201 178 ? ? ? A . n A 1 202 ARG 202 179 ? ? ? A . n A 1 203 SER 203 180 ? ? ? A . n A 1 204 PRO 204 181 ? ? ? A . n A 1 205 ASP 205 182 ? ? ? A . n A 1 206 PHE 206 183 ? ? ? A . n A 1 207 ALA 207 184 ? ? ? A . n A 1 208 SER 208 185 ? ? ? A . n A 1 209 SER 209 186 ? ? ? A . n A 1 210 PHE 210 187 ? ? ? A . n A 1 211 LYS 211 188 ? ? ? A . n A 1 212 ILE 212 189 ? ? ? A . n A 1 213 VAL 213 190 ? ? ? A . n A 1 214 LEU 214 191 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id MG _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 500 _pdbx_nonpoly_scheme.auth_seq_num 500 _pdbx_nonpoly_scheme.pdb_mon_id MG _pdbx_nonpoly_scheme.auth_mon_id MG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L4I _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L4I _struct.title 'The Solution Structure of Magnesium bound CIB1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L4I _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'calcium and integrin binding protein 1, magnesium, integrin, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CIB1_HUMAN _struct_ref.pdbx_db_accession Q99828 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTS PAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEES DIDRDGTINLSEFQHVISRSPDFASSFKIVL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L4I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 214 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q99828 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 191 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 191 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L4I MET A 1 ? UNP Q99828 ? ? 'expression tag' -22 1 1 2L4I GLY A 2 ? UNP Q99828 ? ? 'expression tag' -21 2 1 2L4I HIS A 3 ? UNP Q99828 ? ? 'expression tag' -20 3 1 2L4I HIS A 4 ? UNP Q99828 ? ? 'expression tag' -19 4 1 2L4I HIS A 5 ? UNP Q99828 ? ? 'expression tag' -18 5 1 2L4I HIS A 6 ? UNP Q99828 ? ? 'expression tag' -17 6 1 2L4I HIS A 7 ? UNP Q99828 ? ? 'expression tag' -16 7 1 2L4I HIS A 8 ? UNP Q99828 ? ? 'expression tag' -15 8 1 2L4I HIS A 9 ? UNP Q99828 ? ? 'expression tag' -14 9 1 2L4I HIS A 10 ? UNP Q99828 ? ? 'expression tag' -13 10 1 2L4I HIS A 11 ? UNP Q99828 ? ? 'expression tag' -12 11 1 2L4I HIS A 12 ? UNP Q99828 ? ? 'expression tag' -11 12 1 2L4I SER A 13 ? UNP Q99828 ? ? 'expression tag' -10 13 1 2L4I SER A 14 ? UNP Q99828 ? ? 'expression tag' -9 14 1 2L4I GLY A 15 ? UNP Q99828 ? ? 'expression tag' -8 15 1 2L4I HIS A 16 ? UNP Q99828 ? ? 'expression tag' -7 16 1 2L4I ILE A 17 ? UNP Q99828 ? ? 'expression tag' -6 17 1 2L4I ASP A 18 ? UNP Q99828 ? ? 'expression tag' -5 18 1 2L4I ASP A 19 ? UNP Q99828 ? ? 'expression tag' -4 19 1 2L4I ASP A 20 ? UNP Q99828 ? ? 'expression tag' -3 20 1 2L4I ASP A 21 ? UNP Q99828 ? ? 'expression tag' -2 21 1 2L4I LYS A 22 ? UNP Q99828 ? ? 'expression tag' -1 22 1 2L4I HIS A 23 ? UNP Q99828 ? ? 'expression tag' 0 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 32 ? ASP A 41 ? SER A 9 ASP A 18 1 ? 10 HELX_P HELX_P2 2 LYS A 47 ? ARG A 55 ? LYS A 24 ARG A 32 1 ? 9 HELX_P HELX_P3 3 PRO A 62 ? ARG A 66 ? PRO A 39 ARG A 43 5 ? 5 HELX_P HELX_P4 4 SER A 67 ? LEU A 72 ? SER A 44 LEU A 49 1 ? 6 HELX_P HELX_P5 5 PHE A 78 ? LEU A 82 ? PHE A 55 LEU A 59 1 ? 5 HELX_P HELX_P6 6 LEU A 84 ? ALA A 89 ? LEU A 61 ALA A 66 1 ? 6 HELX_P HELX_P7 7 LYS A 93 ? SER A 101 ? LYS A 70 SER A 78 1 ? 9 HELX_P HELX_P8 8 SER A 110 ? PHE A 121 ? SER A 87 PHE A 98 1 ? 12 HELX_P HELX_P9 9 THR A 126 ? ASP A 139 ? THR A 103 ASP A 116 1 ? 14 HELX_P HELX_P10 10 ASN A 147 ? GLY A 160 ? ASN A 124 GLY A 137 1 ? 14 HELX_P HELX_P11 11 GLU A 171 ? LEU A 180 ? GLU A 148 LEU A 157 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 139 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 116 A MG 500 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc2 metalc ? ? A ASP 139 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 116 A MG 500 1_555 ? ? ? ? ? ? ? 2.902 ? ? metalc3 metalc ? ? A ASP 141 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 118 A MG 500 1_555 ? ? ? ? ? ? ? 2.622 ? ? metalc4 metalc ? ? A ASP 141 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 118 A MG 500 1_555 ? ? ? ? ? ? ? 2.630 ? ? metalc5 metalc ? ? A ASP 143 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 120 A MG 500 1_555 ? ? ? ? ? ? ? 2.678 ? ? metalc6 metalc ? ? A THR 145 O ? ? ? 1_555 B MG . MG ? ? A THR 122 A MG 500 1_555 ? ? ? ? ? ? ? 2.620 ? ? metalc7 metalc ? ? A ASP 150 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 127 A MG 500 1_555 ? ? ? ? ? ? ? 2.792 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 139 ? A ASP 116 ? 1_555 45.7 ? 2 OD1 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 141 ? A ASP 118 ? 1_555 87.2 ? 3 OD2 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 141 ? A ASP 118 ? 1_555 114.3 ? 4 OD1 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 141 ? A ASP 118 ? 1_555 53.9 ? 5 OD2 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 141 ? A ASP 118 ? 1_555 98.7 ? 6 OD2 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 141 ? A ASP 118 ? 1_555 48.4 ? 7 OD1 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 143 ? A ASP 120 ? 1_555 108.3 ? 8 OD2 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 143 ? A ASP 120 ? 1_555 95.3 ? 9 OD2 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 143 ? A ASP 120 ? 1_555 53.1 ? 10 OD1 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD1 ? A ASP 143 ? A ASP 120 ? 1_555 98.9 ? 11 OD1 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O ? A THR 145 ? A THR 122 ? 1_555 130.7 ? 12 OD2 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O ? A THR 145 ? A THR 122 ? 1_555 85.1 ? 13 OD2 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O ? A THR 145 ? A THR 122 ? 1_555 118.5 ? 14 OD1 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O ? A THR 145 ? A THR 122 ? 1_555 166.8 ? 15 OD1 ? A ASP 143 ? A ASP 120 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 O ? A THR 145 ? A THR 122 ? 1_555 68.1 ? 16 OD1 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 150 ? A ASP 127 ? 1_555 71.4 ? 17 OD2 ? A ASP 139 ? A ASP 116 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 150 ? A ASP 127 ? 1_555 75.3 ? 18 OD2 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 150 ? A ASP 127 ? 1_555 138.5 ? 19 OD1 ? A ASP 141 ? A ASP 118 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 150 ? A ASP 127 ? 1_555 91.1 ? 20 OD1 ? A ASP 143 ? A ASP 120 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 150 ? A ASP 127 ? 1_555 167.2 ? 21 O ? A THR 145 ? A THR 122 ? 1_555 MG ? B MG . ? A MG 500 ? 1_555 OD2 ? A ASP 150 ? A ASP 127 ? 1_555 102.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 76 ? PRO A 77 ? VAL A 53 PRO A 54 A 2 SER A 108 ? LEU A 109 ? SER A 85 LEU A 86 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 76 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 53 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id LEU _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 109 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 86 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id MG _struct_site.pdbx_auth_seq_id 500 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE MG A 500' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 ASP A 139 ? ASP A 116 . ? 1_555 ? 2 AC1 5 ASP A 141 ? ASP A 118 . ? 1_555 ? 3 AC1 5 ASP A 143 ? ASP A 120 . ? 1_555 ? 4 AC1 5 THR A 145 ? THR A 122 . ? 1_555 ? 5 AC1 5 ASP A 150 ? ASP A 127 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.33 2 2 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.28 3 2 HG A SER 9 ? ? H A GLU 11 ? ? 1.28 4 2 HG A SER 129 ? ? H A ARG 130 ? ? 1.30 5 3 HG A SER 9 ? ? H A GLU 11 ? ? 1.28 6 3 HG A SER 129 ? ? H A ARG 130 ? ? 1.33 7 3 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.34 8 4 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.27 9 5 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.27 10 5 HG A SER 9 ? ? H A GLU 11 ? ? 1.27 11 5 HG A SER 129 ? ? H A ARG 130 ? ? 1.28 12 5 HG1 A THR 122 ? ? H A LEU 123 ? ? 1.30 13 5 O A PHE 112 ? ? H A ASP 116 ? ? 1.60 14 6 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.28 15 6 HG1 A THR 122 ? ? H A LEU 123 ? ? 1.29 16 6 HG A SER 129 ? ? H A ARG 130 ? ? 1.31 17 6 HG A SER 9 ? ? H A GLU 11 ? ? 1.34 18 7 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.28 19 7 HG A SER 129 ? ? H A ARG 130 ? ? 1.29 20 7 HG1 A THR 122 ? ? H A LEU 123 ? ? 1.31 21 8 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.26 22 8 HG A SER 9 ? ? H A GLU 11 ? ? 1.28 23 8 HG A SER 129 ? ? H A ARG 130 ? ? 1.28 24 9 HG A SER 9 ? ? H A GLU 11 ? ? 1.27 25 9 HH12 A ARG 32 ? ? HH21 A ARG 43 ? ? 1.28 26 10 HG1 A THR 122 ? ? H A LEU 123 ? ? 1.29 27 10 HG A SER 129 ? ? H A ARG 130 ? ? 1.32 28 10 O A LYS 70 ? ? H A ILE 73 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 10 ? ? -58.25 -2.71 2 1 LEU A 19 ? ? -119.71 -120.57 3 1 THR A 20 ? ? -169.36 43.23 4 1 ARG A 32 ? ? -95.14 -83.50 5 1 ARG A 33 ? ? -20.77 -47.16 6 1 CYS A 35 ? ? -44.94 -11.84 7 1 PRO A 39 ? ? -41.79 166.36 8 1 GLU A 41 ? ? -65.75 4.30 9 1 VAL A 45 ? ? -45.82 -19.91 10 1 LEU A 59 ? ? -45.65 -14.91 11 1 LYS A 65 ? ? -39.07 -22.62 12 1 ASP A 84 ? ? -166.25 31.41 13 1 GLU A 89 ? ? -18.67 -90.24 14 1 PHE A 91 ? ? -26.13 -63.03 15 1 ASP A 100 ? ? -77.18 26.24 16 1 ALA A 102 ? ? -68.76 -176.28 17 1 THR A 103 ? ? -52.14 178.51 18 1 SER A 129 ? ? -70.06 -74.94 19 1 ARG A 130 ? ? -39.50 -27.22 20 1 LEU A 131 ? ? -69.55 -89.31 21 1 GLU A 140 ? ? -160.70 -145.10 22 1 THR A 142 ? ? -43.60 -134.23 23 1 ALA A 146 ? ? 178.36 179.26 24 1 MET A 149 ? ? -58.73 -7.08 25 2 LYS A 10 ? ? -54.82 -5.88 26 2 LEU A 19 ? ? -105.84 -122.63 27 2 THR A 20 ? ? -174.30 29.49 28 2 PHE A 21 ? ? -55.10 -2.94 29 2 ARG A 32 ? ? -95.57 -83.07 30 2 ARG A 33 ? ? -20.90 -48.53 31 2 CYS A 35 ? ? -45.04 -11.54 32 2 PRO A 39 ? ? -42.13 165.43 33 2 GLU A 41 ? ? -66.89 4.35 34 2 LEU A 59 ? ? -46.25 -14.72 35 2 ASP A 84 ? ? -164.25 30.99 36 2 GLU A 89 ? ? -18.59 -90.82 37 2 PHE A 91 ? ? -25.44 -63.57 38 2 PHE A 98 ? ? -61.16 0.85 39 2 ASP A 100 ? ? -78.76 31.17 40 2 ALA A 102 ? ? -68.58 -179.58 41 2 THR A 103 ? ? -50.38 178.57 42 2 ASP A 119 ? ? 76.35 40.17 43 2 SER A 129 ? ? -70.01 -77.86 44 2 ARG A 130 ? ? -37.77 -25.48 45 2 LEU A 131 ? ? -71.33 -88.02 46 2 VAL A 132 ? ? -57.76 -7.78 47 2 GLU A 140 ? ? -162.41 -145.55 48 2 THR A 142 ? ? -43.45 -134.53 49 2 SER A 145 ? ? -61.37 97.59 50 2 ALA A 146 ? ? 179.69 176.90 51 2 GLU A 148 ? ? -48.56 -14.21 52 3 LYS A 10 ? ? -66.69 7.95 53 3 ASP A 18 ? ? -60.48 0.52 54 3 LEU A 19 ? ? -122.87 -119.17 55 3 THR A 20 ? ? -168.85 44.70 56 3 ARG A 32 ? ? -95.25 -83.14 57 3 ARG A 33 ? ? -20.21 -48.53 58 3 CYS A 35 ? ? -44.72 -12.03 59 3 PRO A 39 ? ? -41.94 165.08 60 3 GLU A 41 ? ? -65.64 3.87 61 3 VAL A 45 ? ? -45.61 -19.29 62 3 LEU A 59 ? ? -46.45 -14.03 63 3 ASP A 84 ? ? -167.21 31.00 64 3 GLU A 89 ? ? -19.29 -90.30 65 3 PHE A 91 ? ? -25.86 -61.85 66 3 SER A 96 ? ? -58.65 -71.66 67 3 PHE A 98 ? ? -63.76 1.60 68 3 ASP A 100 ? ? -74.37 33.59 69 3 ALA A 102 ? ? -63.78 -169.14 70 3 PRO A 104 ? ? -37.34 -35.43 71 3 THR A 122 ? ? -174.33 -179.67 72 3 SER A 129 ? ? -70.42 -72.84 73 3 ARG A 130 ? ? -39.91 -27.10 74 3 LEU A 131 ? ? -69.71 -88.31 75 3 THR A 142 ? ? -42.48 -134.73 76 3 SER A 145 ? ? -63.93 95.65 77 3 GLU A 148 ? ? -49.27 -14.04 78 4 SER A 9 ? ? -83.81 -157.48 79 4 LYS A 10 ? ? -58.05 -2.69 80 4 ASP A 18 ? ? -61.66 3.22 81 4 LEU A 19 ? ? -129.56 -121.24 82 4 THR A 20 ? ? -167.74 45.79 83 4 ARG A 32 ? ? -94.35 -80.96 84 4 ARG A 33 ? ? -18.23 -46.04 85 4 CYS A 35 ? ? -42.53 -17.25 86 4 PRO A 39 ? ? -41.45 162.54 87 4 GLU A 41 ? ? -64.14 3.84 88 4 LEU A 59 ? ? -47.00 -12.98 89 4 ASP A 84 ? ? -165.77 31.55 90 4 GLU A 89 ? ? -19.16 -83.43 91 4 PHE A 91 ? ? -23.97 -62.59 92 4 PHE A 98 ? ? -66.12 3.88 93 4 ASP A 100 ? ? -75.77 37.28 94 4 ALA A 102 ? ? -65.25 -155.64 95 4 PRO A 104 ? ? -37.84 -35.24 96 4 SER A 129 ? ? -70.75 -74.14 97 4 ARG A 130 ? ? -38.67 -26.46 98 4 LEU A 131 ? ? -70.80 -88.34 99 4 GLU A 140 ? ? -168.99 -144.28 100 4 THR A 142 ? ? -44.36 -132.53 101 4 ALA A 146 ? ? 178.17 -174.77 102 5 LYS A 10 ? ? -53.08 -7.88 103 5 LEU A 19 ? ? -120.79 -120.19 104 5 THR A 20 ? ? -168.34 45.27 105 5 ARG A 32 ? ? -95.11 -83.23 106 5 ARG A 33 ? ? -19.79 -50.26 107 5 CYS A 35 ? ? -44.50 -12.20 108 5 PRO A 39 ? ? -42.18 165.79 109 5 GLU A 41 ? ? -66.97 2.99 110 5 VAL A 45 ? ? -45.26 -18.54 111 5 LEU A 59 ? ? -46.67 -14.54 112 5 LYS A 65 ? ? -38.76 -23.41 113 5 THR A 79 ? ? -107.22 76.61 114 5 ASP A 84 ? ? -163.55 30.37 115 5 GLU A 89 ? ? -18.83 -86.54 116 5 PHE A 91 ? ? -22.15 -62.38 117 5 SER A 96 ? ? -58.23 -82.60 118 5 PHE A 98 ? ? -64.28 5.68 119 5 ALA A 102 ? ? -68.66 -175.92 120 5 THR A 103 ? ? -51.69 178.41 121 5 SER A 129 ? ? -70.96 -73.39 122 5 ARG A 130 ? ? -38.55 -26.16 123 5 LEU A 131 ? ? -71.36 -88.82 124 5 GLU A 140 ? ? -160.72 -145.03 125 5 THR A 142 ? ? -44.33 -133.80 126 5 ALA A 146 ? ? 179.47 -174.62 127 6 LYS A 10 ? ? -65.10 5.02 128 6 ASP A 18 ? ? -64.15 4.77 129 6 LEU A 19 ? ? -125.02 -117.55 130 6 THR A 20 ? ? -168.19 44.25 131 6 ARG A 32 ? ? -94.90 -83.59 132 6 ARG A 33 ? ? -20.60 -48.39 133 6 CYS A 35 ? ? -44.64 -11.68 134 6 PRO A 39 ? ? -41.83 167.23 135 6 GLU A 41 ? ? -66.53 3.63 136 6 VAL A 45 ? ? -45.43 -18.33 137 6 LEU A 59 ? ? -44.68 -17.80 138 6 LYS A 65 ? ? -38.10 -23.80 139 6 THR A 79 ? ? -105.74 76.62 140 6 ASP A 84 ? ? -163.78 29.11 141 6 GLU A 89 ? ? -18.41 -89.30 142 6 PHE A 91 ? ? -24.41 -63.74 143 6 SER A 96 ? ? -60.19 -79.22 144 6 ASP A 100 ? ? -79.91 25.19 145 6 ALA A 102 ? ? -69.55 -178.30 146 6 THR A 103 ? ? -50.00 178.37 147 6 THR A 122 ? ? -174.48 -179.58 148 6 SER A 129 ? ? -71.56 -73.35 149 6 ARG A 130 ? ? -39.02 -26.17 150 6 LEU A 131 ? ? -71.32 -88.25 151 6 THR A 142 ? ? -43.18 -135.43 152 6 SER A 145 ? ? -66.99 97.40 153 6 ALA A 146 ? ? 179.77 175.10 154 6 MET A 149 ? ? -63.22 3.17 155 7 SER A 9 ? ? -89.18 -151.71 156 7 LYS A 10 ? ? -58.40 -1.65 157 7 LEU A 19 ? ? -118.05 -120.62 158 7 THR A 20 ? ? -167.76 44.45 159 7 ARG A 32 ? ? -94.88 -84.69 160 7 ARG A 33 ? ? -18.86 -48.79 161 7 CYS A 35 ? ? -44.85 -11.88 162 7 PRO A 39 ? ? -41.69 169.67 163 7 GLU A 41 ? ? -66.23 2.60 164 7 VAL A 45 ? ? -45.27 -18.45 165 7 LEU A 59 ? ? -45.72 -14.07 166 7 PHE A 69 ? ? -71.25 26.53 167 7 LYS A 70 ? ? -33.84 -31.07 168 7 THR A 79 ? ? -110.76 75.96 169 7 ASP A 84 ? ? -165.96 30.42 170 7 GLU A 89 ? ? -18.58 -90.67 171 7 PHE A 91 ? ? -25.06 -62.75 172 7 SER A 96 ? ? -59.30 -81.41 173 7 PHE A 98 ? ? -67.94 8.37 174 7 ASP A 100 ? ? -75.25 28.78 175 7 ALA A 102 ? ? -62.70 -155.32 176 7 PRO A 104 ? ? -38.56 -22.21 177 7 ARG A 125 ? ? -39.84 -34.87 178 7 SER A 129 ? ? -71.40 -74.38 179 7 ARG A 130 ? ? -38.68 -26.58 180 7 LEU A 131 ? ? -70.62 -88.86 181 7 VAL A 132 ? ? -54.41 -9.02 182 7 THR A 142 ? ? -42.20 -136.02 183 7 SER A 145 ? ? -49.65 101.08 184 7 ALA A 146 ? ? 179.94 -176.57 185 7 MET A 149 ? ? -63.16 3.83 186 8 LYS A 10 ? ? -58.95 -1.75 187 8 ASP A 18 ? ? -65.08 5.87 188 8 LEU A 19 ? ? -129.36 -119.08 189 8 THR A 20 ? ? -168.13 43.94 190 8 ARG A 32 ? ? -94.13 -80.68 191 8 ARG A 33 ? ? -18.50 -45.09 192 8 CYS A 35 ? ? -42.55 -17.49 193 8 PRO A 39 ? ? -41.73 161.04 194 8 GLU A 41 ? ? -64.05 4.58 195 8 VAL A 45 ? ? -45.50 -17.80 196 8 LEU A 59 ? ? -45.87 -13.30 197 8 LYS A 65 ? ? -38.43 -23.39 198 8 ASP A 84 ? ? -163.11 31.44 199 8 GLU A 89 ? ? -19.60 -91.23 200 8 PHE A 91 ? ? -27.37 -61.61 201 8 SER A 96 ? ? -58.73 -71.68 202 8 PHE A 98 ? ? -62.07 1.19 203 8 ASP A 100 ? ? -74.46 37.42 204 8 ALA A 102 ? ? -63.00 -169.71 205 8 PRO A 104 ? ? -37.65 -38.35 206 8 ASP A 119 ? ? 74.91 40.97 207 8 SER A 129 ? ? -70.75 -76.92 208 8 ARG A 130 ? ? -37.81 -25.17 209 8 LEU A 131 ? ? -72.44 -87.26 210 8 VAL A 132 ? ? -58.61 -6.72 211 8 THR A 142 ? ? -42.49 -134.92 212 8 SER A 145 ? ? -69.65 84.86 213 8 GLU A 148 ? ? -55.02 -7.78 214 8 MET A 149 ? ? -66.97 2.89 215 9 LYS A 10 ? ? -55.19 -5.94 216 9 ASP A 18 ? ? -64.21 7.97 217 9 LEU A 19 ? ? -127.15 -114.09 218 9 THR A 20 ? ? -170.29 27.06 219 9 ARG A 32 ? ? -95.62 -82.99 220 9 ARG A 33 ? ? -20.76 -47.78 221 9 CYS A 35 ? ? -45.19 -11.22 222 9 PRO A 39 ? ? -42.03 165.02 223 9 GLU A 41 ? ? -65.70 3.76 224 9 LEU A 59 ? ? -47.03 -13.67 225 9 PRO A 68 ? ? -67.25 -72.16 226 9 THR A 79 ? ? -104.95 74.38 227 9 ASP A 84 ? ? -159.44 30.39 228 9 GLU A 89 ? ? -18.74 -89.27 229 9 PHE A 91 ? ? -22.95 -62.39 230 9 PHE A 98 ? ? -66.77 7.47 231 9 ASP A 100 ? ? -74.75 32.19 232 9 THR A 103 ? ? -52.43 178.55 233 9 SER A 129 ? ? -69.14 -75.05 234 9 ARG A 130 ? ? -39.13 -27.41 235 9 LEU A 131 ? ? -69.43 -89.21 236 9 GLU A 140 ? ? -157.14 -149.61 237 9 THR A 142 ? ? -43.96 -134.44 238 9 SER A 145 ? ? -62.85 94.69 239 9 GLU A 148 ? ? -64.20 0.51 240 10 LYS A 10 ? ? -59.76 -0.25 241 10 ASP A 18 ? ? -59.39 -1.76 242 10 LEU A 19 ? ? -119.85 -119.61 243 10 THR A 20 ? ? -168.05 44.77 244 10 ARG A 32 ? ? -95.42 -83.61 245 10 ARG A 33 ? ? -19.85 -48.77 246 10 CYS A 35 ? ? -44.22 -12.33 247 10 PRO A 39 ? ? -41.95 172.68 248 10 LEU A 59 ? ? -46.50 -14.42 249 10 LYS A 65 ? ? -46.11 -14.32 250 10 LYS A 70 ? ? -58.61 -4.29 251 10 THR A 79 ? ? -109.96 74.92 252 10 ASP A 84 ? ? -172.34 29.27 253 10 GLU A 89 ? ? -18.19 -90.90 254 10 PHE A 91 ? ? -23.90 -64.28 255 10 SER A 96 ? ? -58.78 -71.95 256 10 PHE A 98 ? ? -66.72 2.44 257 10 ASP A 100 ? ? -76.02 31.06 258 10 ALA A 102 ? ? -63.37 -158.56 259 10 PRO A 104 ? ? -37.53 -35.69 260 10 SER A 129 ? ? -70.59 -74.06 261 10 ARG A 130 ? ? -39.19 -26.85 262 10 LEU A 131 ? ? -70.20 -88.61 263 10 THR A 142 ? ? -41.60 -135.12 264 10 LEU A 144 ? ? -51.94 -169.13 265 10 GLU A 148 ? ? -59.91 -2.44 266 10 MET A 149 ? ? -66.40 7.68 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 1.6 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L4I _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 1.8 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 30 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 8 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.077 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.005 _pdbx_nmr_ensemble_rms.entry_id 2L4I _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L4I _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-13C; U-15N; U-2H] CIB1, 5 mM MAGNESIUM ION, 100 mM potassium chloride, 10 mM DTT, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM I/L/V methyl labeled [U, 2H] CIB1, 5 mM MAGNESIUM ION, 100 mM potassium chloride, 10 mM DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CIB1 0.5 ? mM '[U-13C; U-15N; U-2H]' 1 'MAGNESIUM ION' 5 ? mM ? 1 'potassium chloride' 100 ? mM ? 1 DTT 10 ? mM ? 1 CIB1 0.5 ? mM 'I/L/V methyl labeled [U, 2H]' 2 'MAGNESIUM ION' 5 ? mM ? 2 'potassium chloride' 100 ? mM ? 2 DTT 10 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 200 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D IPAP-HSQC' 1 2 1 '3D HNCO type IPAP' 1 3 2 '3D 1H-15N NOESY' 1 4 2 '3D 1H-13C NOESY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L4I _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1007 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 63 _pdbx_nmr_constraints.NOE_long_range_total_count 97 _pdbx_nmr_constraints.NOE_medium_range_total_count 109 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 164 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 147 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 146 # _pdbx_nmr_refine.entry_id 2L4I _pdbx_nmr_refine.method 'simulated annealing, torsion angle dynamics' _pdbx_nmr_refine.details ;Because the backbone resonances of residues 158-191 are largely missing, only residues 8-157 of Mg2+-CIB1 are presented in this entry. Simulated annealing was done in two steps, 1st step, 200k-20k; 2nd step, 20K-2K, refer to J Biomol NMR. 2000 Nov;18(3):217-27. (Chou and Bax) ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.18 1 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.18 2 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -22 ? A MET 1 2 1 Y 1 A GLY -21 ? A GLY 2 3 1 Y 1 A HIS -20 ? A HIS 3 4 1 Y 1 A HIS -19 ? A HIS 4 5 1 Y 1 A HIS -18 ? A HIS 5 6 1 Y 1 A HIS -17 ? A HIS 6 7 1 Y 1 A HIS -16 ? A HIS 7 8 1 Y 1 A HIS -15 ? A HIS 8 9 1 Y 1 A HIS -14 ? A HIS 9 10 1 Y 1 A HIS -13 ? A HIS 10 11 1 Y 1 A HIS -12 ? A HIS 11 12 1 Y 1 A HIS -11 ? A HIS 12 13 1 Y 1 A SER -10 ? A SER 13 14 1 Y 1 A SER -9 ? A SER 14 15 1 Y 1 A GLY -8 ? A GLY 15 16 1 Y 1 A HIS -7 ? A HIS 16 17 1 Y 1 A ILE -6 ? A ILE 17 18 1 Y 1 A ASP -5 ? A ASP 18 19 1 Y 1 A ASP -4 ? A ASP 19 20 1 Y 1 A ASP -3 ? A ASP 20 21 1 Y 1 A ASP -2 ? A ASP 21 22 1 Y 1 A LYS -1 ? A LYS 22 23 1 Y 1 A HIS 0 ? A HIS 23 24 1 Y 1 A MET 1 ? A MET 24 25 1 Y 1 A GLY 2 ? A GLY 25 26 1 Y 1 A GLY 3 ? A GLY 26 27 1 Y 1 A SER 4 ? A SER 27 28 1 Y 1 A GLY 5 ? A GLY 28 29 1 Y 1 A SER 6 ? A SER 29 30 1 Y 1 A ARG 7 ? A ARG 30 31 1 Y 1 A GLU 158 ? A GLU 181 32 1 Y 1 A GLU 159 ? A GLU 182 33 1 Y 1 A SER 160 ? A SER 183 34 1 Y 1 A ASP 161 ? A ASP 184 35 1 Y 1 A ILE 162 ? A ILE 185 36 1 Y 1 A ASP 163 ? A ASP 186 37 1 Y 1 A ARG 164 ? A ARG 187 38 1 Y 1 A ASP 165 ? A ASP 188 39 1 Y 1 A GLY 166 ? A GLY 189 40 1 Y 1 A THR 167 ? A THR 190 41 1 Y 1 A ILE 168 ? A ILE 191 42 1 Y 1 A ASN 169 ? A ASN 192 43 1 Y 1 A LEU 170 ? A LEU 193 44 1 Y 1 A SER 171 ? A SER 194 45 1 Y 1 A GLU 172 ? A GLU 195 46 1 Y 1 A PHE 173 ? A PHE 196 47 1 Y 1 A GLN 174 ? A GLN 197 48 1 Y 1 A HIS 175 ? A HIS 198 49 1 Y 1 A VAL 176 ? A VAL 199 50 1 Y 1 A ILE 177 ? A ILE 200 51 1 Y 1 A SER 178 ? A SER 201 52 1 Y 1 A ARG 179 ? A ARG 202 53 1 Y 1 A SER 180 ? A SER 203 54 1 Y 1 A PRO 181 ? A PRO 204 55 1 Y 1 A ASP 182 ? A ASP 205 56 1 Y 1 A PHE 183 ? A PHE 206 57 1 Y 1 A ALA 184 ? A ALA 207 58 1 Y 1 A SER 185 ? A SER 208 59 1 Y 1 A SER 186 ? A SER 209 60 1 Y 1 A PHE 187 ? A PHE 210 61 1 Y 1 A LYS 188 ? A LYS 211 62 1 Y 1 A ILE 189 ? A ILE 212 63 1 Y 1 A VAL 190 ? A VAL 213 64 1 Y 1 A LEU 191 ? A LEU 214 65 2 Y 1 A MET -22 ? A MET 1 66 2 Y 1 A GLY -21 ? A GLY 2 67 2 Y 1 A HIS -20 ? A HIS 3 68 2 Y 1 A HIS -19 ? A HIS 4 69 2 Y 1 A HIS -18 ? A HIS 5 70 2 Y 1 A HIS -17 ? A HIS 6 71 2 Y 1 A HIS -16 ? A HIS 7 72 2 Y 1 A HIS -15 ? A HIS 8 73 2 Y 1 A HIS -14 ? A HIS 9 74 2 Y 1 A HIS -13 ? A HIS 10 75 2 Y 1 A HIS -12 ? A HIS 11 76 2 Y 1 A HIS -11 ? A HIS 12 77 2 Y 1 A SER -10 ? A SER 13 78 2 Y 1 A SER -9 ? A SER 14 79 2 Y 1 A GLY -8 ? A GLY 15 80 2 Y 1 A HIS -7 ? A HIS 16 81 2 Y 1 A ILE -6 ? A ILE 17 82 2 Y 1 A ASP -5 ? A ASP 18 83 2 Y 1 A ASP -4 ? A ASP 19 84 2 Y 1 A ASP -3 ? A ASP 20 85 2 Y 1 A ASP -2 ? A ASP 21 86 2 Y 1 A LYS -1 ? A LYS 22 87 2 Y 1 A HIS 0 ? A HIS 23 88 2 Y 1 A MET 1 ? A MET 24 89 2 Y 1 A GLY 2 ? A GLY 25 90 2 Y 1 A GLY 3 ? A GLY 26 91 2 Y 1 A SER 4 ? A SER 27 92 2 Y 1 A GLY 5 ? A GLY 28 93 2 Y 1 A SER 6 ? A SER 29 94 2 Y 1 A ARG 7 ? A ARG 30 95 2 Y 1 A GLU 158 ? A GLU 181 96 2 Y 1 A GLU 159 ? A GLU 182 97 2 Y 1 A SER 160 ? A SER 183 98 2 Y 1 A ASP 161 ? A ASP 184 99 2 Y 1 A ILE 162 ? A ILE 185 100 2 Y 1 A ASP 163 ? A ASP 186 101 2 Y 1 A ARG 164 ? A ARG 187 102 2 Y 1 A ASP 165 ? A ASP 188 103 2 Y 1 A GLY 166 ? A GLY 189 104 2 Y 1 A THR 167 ? A THR 190 105 2 Y 1 A ILE 168 ? A ILE 191 106 2 Y 1 A ASN 169 ? A ASN 192 107 2 Y 1 A LEU 170 ? A LEU 193 108 2 Y 1 A SER 171 ? A SER 194 109 2 Y 1 A GLU 172 ? A GLU 195 110 2 Y 1 A PHE 173 ? A PHE 196 111 2 Y 1 A GLN 174 ? A GLN 197 112 2 Y 1 A HIS 175 ? A HIS 198 113 2 Y 1 A VAL 176 ? A VAL 199 114 2 Y 1 A ILE 177 ? A ILE 200 115 2 Y 1 A SER 178 ? A SER 201 116 2 Y 1 A ARG 179 ? A ARG 202 117 2 Y 1 A SER 180 ? A SER 203 118 2 Y 1 A PRO 181 ? A PRO 204 119 2 Y 1 A ASP 182 ? A ASP 205 120 2 Y 1 A PHE 183 ? A PHE 206 121 2 Y 1 A ALA 184 ? A ALA 207 122 2 Y 1 A SER 185 ? A SER 208 123 2 Y 1 A SER 186 ? A SER 209 124 2 Y 1 A PHE 187 ? A PHE 210 125 2 Y 1 A LYS 188 ? A LYS 211 126 2 Y 1 A ILE 189 ? A ILE 212 127 2 Y 1 A VAL 190 ? A VAL 213 128 2 Y 1 A LEU 191 ? A LEU 214 129 3 Y 1 A MET -22 ? A MET 1 130 3 Y 1 A GLY -21 ? A GLY 2 131 3 Y 1 A HIS -20 ? A HIS 3 132 3 Y 1 A HIS -19 ? A HIS 4 133 3 Y 1 A HIS -18 ? A HIS 5 134 3 Y 1 A HIS -17 ? A HIS 6 135 3 Y 1 A HIS -16 ? A HIS 7 136 3 Y 1 A HIS -15 ? A HIS 8 137 3 Y 1 A HIS -14 ? A HIS 9 138 3 Y 1 A HIS -13 ? A HIS 10 139 3 Y 1 A HIS -12 ? A HIS 11 140 3 Y 1 A HIS -11 ? A HIS 12 141 3 Y 1 A SER -10 ? A SER 13 142 3 Y 1 A SER -9 ? A SER 14 143 3 Y 1 A GLY -8 ? A GLY 15 144 3 Y 1 A HIS -7 ? A HIS 16 145 3 Y 1 A ILE -6 ? A ILE 17 146 3 Y 1 A ASP -5 ? A ASP 18 147 3 Y 1 A ASP -4 ? A ASP 19 148 3 Y 1 A ASP -3 ? A ASP 20 149 3 Y 1 A ASP -2 ? A ASP 21 150 3 Y 1 A LYS -1 ? A LYS 22 151 3 Y 1 A HIS 0 ? A HIS 23 152 3 Y 1 A MET 1 ? A MET 24 153 3 Y 1 A GLY 2 ? A GLY 25 154 3 Y 1 A GLY 3 ? A GLY 26 155 3 Y 1 A SER 4 ? A SER 27 156 3 Y 1 A GLY 5 ? A GLY 28 157 3 Y 1 A SER 6 ? A SER 29 158 3 Y 1 A ARG 7 ? A ARG 30 159 3 Y 1 A GLU 158 ? A GLU 181 160 3 Y 1 A GLU 159 ? A GLU 182 161 3 Y 1 A SER 160 ? A SER 183 162 3 Y 1 A ASP 161 ? A ASP 184 163 3 Y 1 A ILE 162 ? A ILE 185 164 3 Y 1 A ASP 163 ? A ASP 186 165 3 Y 1 A ARG 164 ? A ARG 187 166 3 Y 1 A ASP 165 ? A ASP 188 167 3 Y 1 A GLY 166 ? A GLY 189 168 3 Y 1 A THR 167 ? A THR 190 169 3 Y 1 A ILE 168 ? A ILE 191 170 3 Y 1 A ASN 169 ? A ASN 192 171 3 Y 1 A LEU 170 ? A LEU 193 172 3 Y 1 A SER 171 ? A SER 194 173 3 Y 1 A GLU 172 ? A GLU 195 174 3 Y 1 A PHE 173 ? A PHE 196 175 3 Y 1 A GLN 174 ? A GLN 197 176 3 Y 1 A HIS 175 ? A HIS 198 177 3 Y 1 A VAL 176 ? A VAL 199 178 3 Y 1 A ILE 177 ? A ILE 200 179 3 Y 1 A SER 178 ? A SER 201 180 3 Y 1 A ARG 179 ? A ARG 202 181 3 Y 1 A SER 180 ? A SER 203 182 3 Y 1 A PRO 181 ? A PRO 204 183 3 Y 1 A ASP 182 ? A ASP 205 184 3 Y 1 A PHE 183 ? A PHE 206 185 3 Y 1 A ALA 184 ? A ALA 207 186 3 Y 1 A SER 185 ? A SER 208 187 3 Y 1 A SER 186 ? A SER 209 188 3 Y 1 A PHE 187 ? A PHE 210 189 3 Y 1 A LYS 188 ? A LYS 211 190 3 Y 1 A ILE 189 ? A ILE 212 191 3 Y 1 A VAL 190 ? A VAL 213 192 3 Y 1 A LEU 191 ? A LEU 214 193 4 Y 1 A MET -22 ? A MET 1 194 4 Y 1 A GLY -21 ? A GLY 2 195 4 Y 1 A HIS -20 ? A HIS 3 196 4 Y 1 A HIS -19 ? A HIS 4 197 4 Y 1 A HIS -18 ? A HIS 5 198 4 Y 1 A HIS -17 ? A HIS 6 199 4 Y 1 A HIS -16 ? A HIS 7 200 4 Y 1 A HIS -15 ? A HIS 8 201 4 Y 1 A HIS -14 ? A HIS 9 202 4 Y 1 A HIS -13 ? A HIS 10 203 4 Y 1 A HIS -12 ? A HIS 11 204 4 Y 1 A HIS -11 ? A HIS 12 205 4 Y 1 A SER -10 ? A SER 13 206 4 Y 1 A SER -9 ? A SER 14 207 4 Y 1 A GLY -8 ? A GLY 15 208 4 Y 1 A HIS -7 ? A HIS 16 209 4 Y 1 A ILE -6 ? A ILE 17 210 4 Y 1 A ASP -5 ? A ASP 18 211 4 Y 1 A ASP -4 ? A ASP 19 212 4 Y 1 A ASP -3 ? A ASP 20 213 4 Y 1 A ASP -2 ? A ASP 21 214 4 Y 1 A LYS -1 ? A LYS 22 215 4 Y 1 A HIS 0 ? A HIS 23 216 4 Y 1 A MET 1 ? A MET 24 217 4 Y 1 A GLY 2 ? A GLY 25 218 4 Y 1 A GLY 3 ? A GLY 26 219 4 Y 1 A SER 4 ? A SER 27 220 4 Y 1 A GLY 5 ? A GLY 28 221 4 Y 1 A SER 6 ? A SER 29 222 4 Y 1 A ARG 7 ? A ARG 30 223 4 Y 1 A GLU 158 ? A GLU 181 224 4 Y 1 A GLU 159 ? A GLU 182 225 4 Y 1 A SER 160 ? A SER 183 226 4 Y 1 A ASP 161 ? A ASP 184 227 4 Y 1 A ILE 162 ? A ILE 185 228 4 Y 1 A ASP 163 ? A ASP 186 229 4 Y 1 A ARG 164 ? A ARG 187 230 4 Y 1 A ASP 165 ? A ASP 188 231 4 Y 1 A GLY 166 ? A GLY 189 232 4 Y 1 A THR 167 ? A THR 190 233 4 Y 1 A ILE 168 ? A ILE 191 234 4 Y 1 A ASN 169 ? A ASN 192 235 4 Y 1 A LEU 170 ? A LEU 193 236 4 Y 1 A SER 171 ? A SER 194 237 4 Y 1 A GLU 172 ? A GLU 195 238 4 Y 1 A PHE 173 ? A PHE 196 239 4 Y 1 A GLN 174 ? A GLN 197 240 4 Y 1 A HIS 175 ? A HIS 198 241 4 Y 1 A VAL 176 ? A VAL 199 242 4 Y 1 A ILE 177 ? A ILE 200 243 4 Y 1 A SER 178 ? A SER 201 244 4 Y 1 A ARG 179 ? A ARG 202 245 4 Y 1 A SER 180 ? A SER 203 246 4 Y 1 A PRO 181 ? A PRO 204 247 4 Y 1 A ASP 182 ? A ASP 205 248 4 Y 1 A PHE 183 ? A PHE 206 249 4 Y 1 A ALA 184 ? A ALA 207 250 4 Y 1 A SER 185 ? A SER 208 251 4 Y 1 A SER 186 ? A SER 209 252 4 Y 1 A PHE 187 ? A PHE 210 253 4 Y 1 A LYS 188 ? A LYS 211 254 4 Y 1 A ILE 189 ? A ILE 212 255 4 Y 1 A VAL 190 ? A VAL 213 256 4 Y 1 A LEU 191 ? A LEU 214 257 5 Y 1 A MET -22 ? A MET 1 258 5 Y 1 A GLY -21 ? A GLY 2 259 5 Y 1 A HIS -20 ? A HIS 3 260 5 Y 1 A HIS -19 ? A HIS 4 261 5 Y 1 A HIS -18 ? A HIS 5 262 5 Y 1 A HIS -17 ? A HIS 6 263 5 Y 1 A HIS -16 ? A HIS 7 264 5 Y 1 A HIS -15 ? A HIS 8 265 5 Y 1 A HIS -14 ? A HIS 9 266 5 Y 1 A HIS -13 ? A HIS 10 267 5 Y 1 A HIS -12 ? A HIS 11 268 5 Y 1 A HIS -11 ? A HIS 12 269 5 Y 1 A SER -10 ? A SER 13 270 5 Y 1 A SER -9 ? A SER 14 271 5 Y 1 A GLY -8 ? A GLY 15 272 5 Y 1 A HIS -7 ? A HIS 16 273 5 Y 1 A ILE -6 ? A ILE 17 274 5 Y 1 A ASP -5 ? A ASP 18 275 5 Y 1 A ASP -4 ? A ASP 19 276 5 Y 1 A ASP -3 ? A ASP 20 277 5 Y 1 A ASP -2 ? A ASP 21 278 5 Y 1 A LYS -1 ? A LYS 22 279 5 Y 1 A HIS 0 ? A HIS 23 280 5 Y 1 A MET 1 ? A MET 24 281 5 Y 1 A GLY 2 ? A GLY 25 282 5 Y 1 A GLY 3 ? A GLY 26 283 5 Y 1 A SER 4 ? A SER 27 284 5 Y 1 A GLY 5 ? A GLY 28 285 5 Y 1 A SER 6 ? A SER 29 286 5 Y 1 A ARG 7 ? A ARG 30 287 5 Y 1 A GLU 158 ? A GLU 181 288 5 Y 1 A GLU 159 ? A GLU 182 289 5 Y 1 A SER 160 ? A SER 183 290 5 Y 1 A ASP 161 ? A ASP 184 291 5 Y 1 A ILE 162 ? A ILE 185 292 5 Y 1 A ASP 163 ? A ASP 186 293 5 Y 1 A ARG 164 ? A ARG 187 294 5 Y 1 A ASP 165 ? A ASP 188 295 5 Y 1 A GLY 166 ? A GLY 189 296 5 Y 1 A THR 167 ? A THR 190 297 5 Y 1 A ILE 168 ? A ILE 191 298 5 Y 1 A ASN 169 ? A ASN 192 299 5 Y 1 A LEU 170 ? A LEU 193 300 5 Y 1 A SER 171 ? A SER 194 301 5 Y 1 A GLU 172 ? A GLU 195 302 5 Y 1 A PHE 173 ? A PHE 196 303 5 Y 1 A GLN 174 ? A GLN 197 304 5 Y 1 A HIS 175 ? A HIS 198 305 5 Y 1 A VAL 176 ? A VAL 199 306 5 Y 1 A ILE 177 ? A ILE 200 307 5 Y 1 A SER 178 ? A SER 201 308 5 Y 1 A ARG 179 ? A ARG 202 309 5 Y 1 A SER 180 ? A SER 203 310 5 Y 1 A PRO 181 ? A PRO 204 311 5 Y 1 A ASP 182 ? A ASP 205 312 5 Y 1 A PHE 183 ? A PHE 206 313 5 Y 1 A ALA 184 ? A ALA 207 314 5 Y 1 A SER 185 ? A SER 208 315 5 Y 1 A SER 186 ? A SER 209 316 5 Y 1 A PHE 187 ? A PHE 210 317 5 Y 1 A LYS 188 ? A LYS 211 318 5 Y 1 A ILE 189 ? A ILE 212 319 5 Y 1 A VAL 190 ? A VAL 213 320 5 Y 1 A LEU 191 ? A LEU 214 321 6 Y 1 A MET -22 ? A MET 1 322 6 Y 1 A GLY -21 ? A GLY 2 323 6 Y 1 A HIS -20 ? A HIS 3 324 6 Y 1 A HIS -19 ? A HIS 4 325 6 Y 1 A HIS -18 ? A HIS 5 326 6 Y 1 A HIS -17 ? A HIS 6 327 6 Y 1 A HIS -16 ? A HIS 7 328 6 Y 1 A HIS -15 ? A HIS 8 329 6 Y 1 A HIS -14 ? A HIS 9 330 6 Y 1 A HIS -13 ? A HIS 10 331 6 Y 1 A HIS -12 ? A HIS 11 332 6 Y 1 A HIS -11 ? A HIS 12 333 6 Y 1 A SER -10 ? A SER 13 334 6 Y 1 A SER -9 ? A SER 14 335 6 Y 1 A GLY -8 ? A GLY 15 336 6 Y 1 A HIS -7 ? A HIS 16 337 6 Y 1 A ILE -6 ? A ILE 17 338 6 Y 1 A ASP -5 ? A ASP 18 339 6 Y 1 A ASP -4 ? A ASP 19 340 6 Y 1 A ASP -3 ? A ASP 20 341 6 Y 1 A ASP -2 ? A ASP 21 342 6 Y 1 A LYS -1 ? A LYS 22 343 6 Y 1 A HIS 0 ? A HIS 23 344 6 Y 1 A MET 1 ? A MET 24 345 6 Y 1 A GLY 2 ? A GLY 25 346 6 Y 1 A GLY 3 ? A GLY 26 347 6 Y 1 A SER 4 ? A SER 27 348 6 Y 1 A GLY 5 ? A GLY 28 349 6 Y 1 A SER 6 ? A SER 29 350 6 Y 1 A ARG 7 ? A ARG 30 351 6 Y 1 A GLU 158 ? A GLU 181 352 6 Y 1 A GLU 159 ? A GLU 182 353 6 Y 1 A SER 160 ? A SER 183 354 6 Y 1 A ASP 161 ? A ASP 184 355 6 Y 1 A ILE 162 ? A ILE 185 356 6 Y 1 A ASP 163 ? A ASP 186 357 6 Y 1 A ARG 164 ? A ARG 187 358 6 Y 1 A ASP 165 ? A ASP 188 359 6 Y 1 A GLY 166 ? A GLY 189 360 6 Y 1 A THR 167 ? A THR 190 361 6 Y 1 A ILE 168 ? A ILE 191 362 6 Y 1 A ASN 169 ? A ASN 192 363 6 Y 1 A LEU 170 ? A LEU 193 364 6 Y 1 A SER 171 ? A SER 194 365 6 Y 1 A GLU 172 ? A GLU 195 366 6 Y 1 A PHE 173 ? A PHE 196 367 6 Y 1 A GLN 174 ? A GLN 197 368 6 Y 1 A HIS 175 ? A HIS 198 369 6 Y 1 A VAL 176 ? A VAL 199 370 6 Y 1 A ILE 177 ? A ILE 200 371 6 Y 1 A SER 178 ? A SER 201 372 6 Y 1 A ARG 179 ? A ARG 202 373 6 Y 1 A SER 180 ? A SER 203 374 6 Y 1 A PRO 181 ? A PRO 204 375 6 Y 1 A ASP 182 ? A ASP 205 376 6 Y 1 A PHE 183 ? A PHE 206 377 6 Y 1 A ALA 184 ? A ALA 207 378 6 Y 1 A SER 185 ? A SER 208 379 6 Y 1 A SER 186 ? A SER 209 380 6 Y 1 A PHE 187 ? A PHE 210 381 6 Y 1 A LYS 188 ? A LYS 211 382 6 Y 1 A ILE 189 ? A ILE 212 383 6 Y 1 A VAL 190 ? A VAL 213 384 6 Y 1 A LEU 191 ? A LEU 214 385 7 Y 1 A MET -22 ? A MET 1 386 7 Y 1 A GLY -21 ? A GLY 2 387 7 Y 1 A HIS -20 ? A HIS 3 388 7 Y 1 A HIS -19 ? A HIS 4 389 7 Y 1 A HIS -18 ? A HIS 5 390 7 Y 1 A HIS -17 ? A HIS 6 391 7 Y 1 A HIS -16 ? A HIS 7 392 7 Y 1 A HIS -15 ? A HIS 8 393 7 Y 1 A HIS -14 ? A HIS 9 394 7 Y 1 A HIS -13 ? A HIS 10 395 7 Y 1 A HIS -12 ? A HIS 11 396 7 Y 1 A HIS -11 ? A HIS 12 397 7 Y 1 A SER -10 ? A SER 13 398 7 Y 1 A SER -9 ? A SER 14 399 7 Y 1 A GLY -8 ? A GLY 15 400 7 Y 1 A HIS -7 ? A HIS 16 401 7 Y 1 A ILE -6 ? A ILE 17 402 7 Y 1 A ASP -5 ? A ASP 18 403 7 Y 1 A ASP -4 ? A ASP 19 404 7 Y 1 A ASP -3 ? A ASP 20 405 7 Y 1 A ASP -2 ? A ASP 21 406 7 Y 1 A LYS -1 ? A LYS 22 407 7 Y 1 A HIS 0 ? A HIS 23 408 7 Y 1 A MET 1 ? A MET 24 409 7 Y 1 A GLY 2 ? A GLY 25 410 7 Y 1 A GLY 3 ? A GLY 26 411 7 Y 1 A SER 4 ? A SER 27 412 7 Y 1 A GLY 5 ? A GLY 28 413 7 Y 1 A SER 6 ? A SER 29 414 7 Y 1 A ARG 7 ? A ARG 30 415 7 Y 1 A GLU 158 ? A GLU 181 416 7 Y 1 A GLU 159 ? A GLU 182 417 7 Y 1 A SER 160 ? A SER 183 418 7 Y 1 A ASP 161 ? A ASP 184 419 7 Y 1 A ILE 162 ? A ILE 185 420 7 Y 1 A ASP 163 ? A ASP 186 421 7 Y 1 A ARG 164 ? A ARG 187 422 7 Y 1 A ASP 165 ? A ASP 188 423 7 Y 1 A GLY 166 ? A GLY 189 424 7 Y 1 A THR 167 ? A THR 190 425 7 Y 1 A ILE 168 ? A ILE 191 426 7 Y 1 A ASN 169 ? A ASN 192 427 7 Y 1 A LEU 170 ? A LEU 193 428 7 Y 1 A SER 171 ? A SER 194 429 7 Y 1 A GLU 172 ? A GLU 195 430 7 Y 1 A PHE 173 ? A PHE 196 431 7 Y 1 A GLN 174 ? A GLN 197 432 7 Y 1 A HIS 175 ? A HIS 198 433 7 Y 1 A VAL 176 ? A VAL 199 434 7 Y 1 A ILE 177 ? A ILE 200 435 7 Y 1 A SER 178 ? A SER 201 436 7 Y 1 A ARG 179 ? A ARG 202 437 7 Y 1 A SER 180 ? A SER 203 438 7 Y 1 A PRO 181 ? A PRO 204 439 7 Y 1 A ASP 182 ? A ASP 205 440 7 Y 1 A PHE 183 ? A PHE 206 441 7 Y 1 A ALA 184 ? A ALA 207 442 7 Y 1 A SER 185 ? A SER 208 443 7 Y 1 A SER 186 ? A SER 209 444 7 Y 1 A PHE 187 ? A PHE 210 445 7 Y 1 A LYS 188 ? A LYS 211 446 7 Y 1 A ILE 189 ? A ILE 212 447 7 Y 1 A VAL 190 ? A VAL 213 448 7 Y 1 A LEU 191 ? A LEU 214 449 8 Y 1 A MET -22 ? A MET 1 450 8 Y 1 A GLY -21 ? A GLY 2 451 8 Y 1 A HIS -20 ? A HIS 3 452 8 Y 1 A HIS -19 ? A HIS 4 453 8 Y 1 A HIS -18 ? A HIS 5 454 8 Y 1 A HIS -17 ? A HIS 6 455 8 Y 1 A HIS -16 ? A HIS 7 456 8 Y 1 A HIS -15 ? A HIS 8 457 8 Y 1 A HIS -14 ? A HIS 9 458 8 Y 1 A HIS -13 ? A HIS 10 459 8 Y 1 A HIS -12 ? A HIS 11 460 8 Y 1 A HIS -11 ? A HIS 12 461 8 Y 1 A SER -10 ? A SER 13 462 8 Y 1 A SER -9 ? A SER 14 463 8 Y 1 A GLY -8 ? A GLY 15 464 8 Y 1 A HIS -7 ? A HIS 16 465 8 Y 1 A ILE -6 ? A ILE 17 466 8 Y 1 A ASP -5 ? A ASP 18 467 8 Y 1 A ASP -4 ? A ASP 19 468 8 Y 1 A ASP -3 ? A ASP 20 469 8 Y 1 A ASP -2 ? A ASP 21 470 8 Y 1 A LYS -1 ? A LYS 22 471 8 Y 1 A HIS 0 ? A HIS 23 472 8 Y 1 A MET 1 ? A MET 24 473 8 Y 1 A GLY 2 ? A GLY 25 474 8 Y 1 A GLY 3 ? A GLY 26 475 8 Y 1 A SER 4 ? A SER 27 476 8 Y 1 A GLY 5 ? A GLY 28 477 8 Y 1 A SER 6 ? A SER 29 478 8 Y 1 A ARG 7 ? A ARG 30 479 8 Y 1 A GLU 158 ? A GLU 181 480 8 Y 1 A GLU 159 ? A GLU 182 481 8 Y 1 A SER 160 ? A SER 183 482 8 Y 1 A ASP 161 ? A ASP 184 483 8 Y 1 A ILE 162 ? A ILE 185 484 8 Y 1 A ASP 163 ? A ASP 186 485 8 Y 1 A ARG 164 ? A ARG 187 486 8 Y 1 A ASP 165 ? A ASP 188 487 8 Y 1 A GLY 166 ? A GLY 189 488 8 Y 1 A THR 167 ? A THR 190 489 8 Y 1 A ILE 168 ? A ILE 191 490 8 Y 1 A ASN 169 ? A ASN 192 491 8 Y 1 A LEU 170 ? A LEU 193 492 8 Y 1 A SER 171 ? A SER 194 493 8 Y 1 A GLU 172 ? A GLU 195 494 8 Y 1 A PHE 173 ? A PHE 196 495 8 Y 1 A GLN 174 ? A GLN 197 496 8 Y 1 A HIS 175 ? A HIS 198 497 8 Y 1 A VAL 176 ? A VAL 199 498 8 Y 1 A ILE 177 ? A ILE 200 499 8 Y 1 A SER 178 ? A SER 201 500 8 Y 1 A ARG 179 ? A ARG 202 501 8 Y 1 A SER 180 ? A SER 203 502 8 Y 1 A PRO 181 ? A PRO 204 503 8 Y 1 A ASP 182 ? A ASP 205 504 8 Y 1 A PHE 183 ? A PHE 206 505 8 Y 1 A ALA 184 ? A ALA 207 506 8 Y 1 A SER 185 ? A SER 208 507 8 Y 1 A SER 186 ? A SER 209 508 8 Y 1 A PHE 187 ? A PHE 210 509 8 Y 1 A LYS 188 ? A LYS 211 510 8 Y 1 A ILE 189 ? A ILE 212 511 8 Y 1 A VAL 190 ? A VAL 213 512 8 Y 1 A LEU 191 ? A LEU 214 513 9 Y 1 A MET -22 ? A MET 1 514 9 Y 1 A GLY -21 ? A GLY 2 515 9 Y 1 A HIS -20 ? A HIS 3 516 9 Y 1 A HIS -19 ? A HIS 4 517 9 Y 1 A HIS -18 ? A HIS 5 518 9 Y 1 A HIS -17 ? A HIS 6 519 9 Y 1 A HIS -16 ? A HIS 7 520 9 Y 1 A HIS -15 ? A HIS 8 521 9 Y 1 A HIS -14 ? A HIS 9 522 9 Y 1 A HIS -13 ? A HIS 10 523 9 Y 1 A HIS -12 ? A HIS 11 524 9 Y 1 A HIS -11 ? A HIS 12 525 9 Y 1 A SER -10 ? A SER 13 526 9 Y 1 A SER -9 ? A SER 14 527 9 Y 1 A GLY -8 ? A GLY 15 528 9 Y 1 A HIS -7 ? A HIS 16 529 9 Y 1 A ILE -6 ? A ILE 17 530 9 Y 1 A ASP -5 ? A ASP 18 531 9 Y 1 A ASP -4 ? A ASP 19 532 9 Y 1 A ASP -3 ? A ASP 20 533 9 Y 1 A ASP -2 ? A ASP 21 534 9 Y 1 A LYS -1 ? A LYS 22 535 9 Y 1 A HIS 0 ? A HIS 23 536 9 Y 1 A MET 1 ? A MET 24 537 9 Y 1 A GLY 2 ? A GLY 25 538 9 Y 1 A GLY 3 ? A GLY 26 539 9 Y 1 A SER 4 ? A SER 27 540 9 Y 1 A GLY 5 ? A GLY 28 541 9 Y 1 A SER 6 ? A SER 29 542 9 Y 1 A ARG 7 ? A ARG 30 543 9 Y 1 A GLU 158 ? A GLU 181 544 9 Y 1 A GLU 159 ? A GLU 182 545 9 Y 1 A SER 160 ? A SER 183 546 9 Y 1 A ASP 161 ? A ASP 184 547 9 Y 1 A ILE 162 ? A ILE 185 548 9 Y 1 A ASP 163 ? A ASP 186 549 9 Y 1 A ARG 164 ? A ARG 187 550 9 Y 1 A ASP 165 ? A ASP 188 551 9 Y 1 A GLY 166 ? A GLY 189 552 9 Y 1 A THR 167 ? A THR 190 553 9 Y 1 A ILE 168 ? A ILE 191 554 9 Y 1 A ASN 169 ? A ASN 192 555 9 Y 1 A LEU 170 ? A LEU 193 556 9 Y 1 A SER 171 ? A SER 194 557 9 Y 1 A GLU 172 ? A GLU 195 558 9 Y 1 A PHE 173 ? A PHE 196 559 9 Y 1 A GLN 174 ? A GLN 197 560 9 Y 1 A HIS 175 ? A HIS 198 561 9 Y 1 A VAL 176 ? A VAL 199 562 9 Y 1 A ILE 177 ? A ILE 200 563 9 Y 1 A SER 178 ? A SER 201 564 9 Y 1 A ARG 179 ? A ARG 202 565 9 Y 1 A SER 180 ? A SER 203 566 9 Y 1 A PRO 181 ? A PRO 204 567 9 Y 1 A ASP 182 ? A ASP 205 568 9 Y 1 A PHE 183 ? A PHE 206 569 9 Y 1 A ALA 184 ? A ALA 207 570 9 Y 1 A SER 185 ? A SER 208 571 9 Y 1 A SER 186 ? A SER 209 572 9 Y 1 A PHE 187 ? A PHE 210 573 9 Y 1 A LYS 188 ? A LYS 211 574 9 Y 1 A ILE 189 ? A ILE 212 575 9 Y 1 A VAL 190 ? A VAL 213 576 9 Y 1 A LEU 191 ? A LEU 214 577 10 Y 1 A MET -22 ? A MET 1 578 10 Y 1 A GLY -21 ? A GLY 2 579 10 Y 1 A HIS -20 ? A HIS 3 580 10 Y 1 A HIS -19 ? A HIS 4 581 10 Y 1 A HIS -18 ? A HIS 5 582 10 Y 1 A HIS -17 ? A HIS 6 583 10 Y 1 A HIS -16 ? A HIS 7 584 10 Y 1 A HIS -15 ? A HIS 8 585 10 Y 1 A HIS -14 ? A HIS 9 586 10 Y 1 A HIS -13 ? A HIS 10 587 10 Y 1 A HIS -12 ? A HIS 11 588 10 Y 1 A HIS -11 ? A HIS 12 589 10 Y 1 A SER -10 ? A SER 13 590 10 Y 1 A SER -9 ? A SER 14 591 10 Y 1 A GLY -8 ? A GLY 15 592 10 Y 1 A HIS -7 ? A HIS 16 593 10 Y 1 A ILE -6 ? A ILE 17 594 10 Y 1 A ASP -5 ? A ASP 18 595 10 Y 1 A ASP -4 ? A ASP 19 596 10 Y 1 A ASP -3 ? A ASP 20 597 10 Y 1 A ASP -2 ? A ASP 21 598 10 Y 1 A LYS -1 ? A LYS 22 599 10 Y 1 A HIS 0 ? A HIS 23 600 10 Y 1 A MET 1 ? A MET 24 601 10 Y 1 A GLY 2 ? A GLY 25 602 10 Y 1 A GLY 3 ? A GLY 26 603 10 Y 1 A SER 4 ? A SER 27 604 10 Y 1 A GLY 5 ? A GLY 28 605 10 Y 1 A SER 6 ? A SER 29 606 10 Y 1 A ARG 7 ? A ARG 30 607 10 Y 1 A GLU 158 ? A GLU 181 608 10 Y 1 A GLU 159 ? A GLU 182 609 10 Y 1 A SER 160 ? A SER 183 610 10 Y 1 A ASP 161 ? A ASP 184 611 10 Y 1 A ILE 162 ? A ILE 185 612 10 Y 1 A ASP 163 ? A ASP 186 613 10 Y 1 A ARG 164 ? A ARG 187 614 10 Y 1 A ASP 165 ? A ASP 188 615 10 Y 1 A GLY 166 ? A GLY 189 616 10 Y 1 A THR 167 ? A THR 190 617 10 Y 1 A ILE 168 ? A ILE 191 618 10 Y 1 A ASN 169 ? A ASN 192 619 10 Y 1 A LEU 170 ? A LEU 193 620 10 Y 1 A SER 171 ? A SER 194 621 10 Y 1 A GLU 172 ? A GLU 195 622 10 Y 1 A PHE 173 ? A PHE 196 623 10 Y 1 A GLN 174 ? A GLN 197 624 10 Y 1 A HIS 175 ? A HIS 198 625 10 Y 1 A VAL 176 ? A VAL 199 626 10 Y 1 A ILE 177 ? A ILE 200 627 10 Y 1 A SER 178 ? A SER 201 628 10 Y 1 A ARG 179 ? A ARG 202 629 10 Y 1 A SER 180 ? A SER 203 630 10 Y 1 A PRO 181 ? A PRO 204 631 10 Y 1 A ASP 182 ? A ASP 205 632 10 Y 1 A PHE 183 ? A PHE 206 633 10 Y 1 A ALA 184 ? A ALA 207 634 10 Y 1 A SER 185 ? A SER 208 635 10 Y 1 A SER 186 ? A SER 209 636 10 Y 1 A PHE 187 ? A PHE 210 637 10 Y 1 A LYS 188 ? A LYS 211 638 10 Y 1 A ILE 189 ? A ILE 212 639 10 Y 1 A VAL 190 ? A VAL 213 640 10 Y 1 A LEU 191 ? A LEU 214 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MG MG MG N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _atom_sites.entry_id 2L4I _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H MG N O S # loop_ #