data_2L57 # _entry.id 2L57 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L57 pdb_00002l57 10.2210/pdb2l57/pdb RCSB RCSB101971 ? ? WWPDB D_1000101971 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-05-08 4 'Structure model' 1 3 2018-11-14 5 'Structure model' 1 4 2021-02-10 6 'Structure model' 1 5 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 5 'Structure model' audit_author 3 5 'Structure model' citation_author 4 5 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' struct_ref_seq_dif 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 5 'Structure model' '_audit_author.identifier_ORCID' 3 5 'Structure model' '_citation_author.identifier_ORCID' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_ref_seq_dif.details' 6 6 'Structure model' '_database_2.pdbx_DOI' 7 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L57 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-10-26 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGXRC-11217h TargetDB . unspecified NYSGRC-011325 TargetTrack . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Harris, R.' 1 ? 'Foti, R.' 2 ? 'Seidel, R.D.' 3 ? 'Bonanno, J.B.' 4 ? 'Freeman, J.' 5 ? 'Bain, K.T.' 6 ? 'Sauder, J.M.' 7 0000-0002-0254-4955 'Burley, S.K.' 8 0000-0002-2487-9713 'Girvin, M.E.' 9 ? 'Almo, S.C.' 10 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ? 'New York Structural Genomics Research Consortium (NYSGRC)' 12 ? # _citation.id primary _citation.title 'Solution Structure of an Uncharacterized Thioredoin-like Protein from Clostridium perfringens' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Foti, R.' 2 ? primary 'Seidel, R.D.' 3 ? primary 'Bonanno, J.B.' 4 ? primary 'Freeman, J.' 5 ? primary 'Bain, K.T.' 6 ? primary 'Sauder, J.M.' 7 ? primary 'Burley, S.K.' 8 0000-0002-2487-9713 primary 'Girvin, M.E.' 9 ? primary 'Almo, S.C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 14739.773 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 28-142' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDA NIVPTTVFLDKEGNKFYVHQGLMRKNNIETILNSLGVKEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLEGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDA NIVPTTVFLDKEGNKFYVHQGLMRKNNIETILNSLGVKEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 'NYSGXRC-11217h, NYSGRC-011325' # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 GLU n 1 5 GLY n 1 6 ILE n 1 7 LYS n 1 8 GLN n 1 9 ILE n 1 10 ASN n 1 11 PHE n 1 12 GLN n 1 13 SER n 1 14 ILE n 1 15 ASN n 1 16 VAL n 1 17 VAL n 1 18 GLU n 1 19 ASN n 1 20 LEU n 1 21 GLU n 1 22 GLU n 1 23 ALA n 1 24 LYS n 1 25 GLU n 1 26 GLY n 1 27 ILE n 1 28 PRO n 1 29 THR n 1 30 ILE n 1 31 ILE n 1 32 MET n 1 33 PHE n 1 34 LYS n 1 35 THR n 1 36 ASP n 1 37 THR n 1 38 CYS n 1 39 PRO n 1 40 TYR n 1 41 CYS n 1 42 VAL n 1 43 GLU n 1 44 MET n 1 45 GLN n 1 46 LYS n 1 47 GLU n 1 48 LEU n 1 49 SER n 1 50 TYR n 1 51 VAL n 1 52 SER n 1 53 LYS n 1 54 GLU n 1 55 ARG n 1 56 GLU n 1 57 GLY n 1 58 LYS n 1 59 PHE n 1 60 ASN n 1 61 ILE n 1 62 TYR n 1 63 TYR n 1 64 ALA n 1 65 ARG n 1 66 LEU n 1 67 GLU n 1 68 GLU n 1 69 GLU n 1 70 LYS n 1 71 ASN n 1 72 ILE n 1 73 ASP n 1 74 LEU n 1 75 ALA n 1 76 TYR n 1 77 LYS n 1 78 TYR n 1 79 ASP n 1 80 ALA n 1 81 ASN n 1 82 ILE n 1 83 VAL n 1 84 PRO n 1 85 THR n 1 86 THR n 1 87 VAL n 1 88 PHE n 1 89 LEU n 1 90 ASP n 1 91 LYS n 1 92 GLU n 1 93 GLY n 1 94 ASN n 1 95 LYS n 1 96 PHE n 1 97 TYR n 1 98 VAL n 1 99 HIS n 1 100 GLN n 1 101 GLY n 1 102 LEU n 1 103 MET n 1 104 ARG n 1 105 LYS n 1 106 ASN n 1 107 ASN n 1 108 ILE n 1 109 GLU n 1 110 THR n 1 111 ILE n 1 112 LEU n 1 113 ASN n 1 114 SER n 1 115 LEU n 1 116 GLY n 1 117 VAL n 1 118 LYS n 1 119 GLU n 1 120 GLY n 1 121 HIS n 1 122 HIS n 1 123 HIS n 1 124 HIS n 1 125 HIS n 1 126 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CPF_2862 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 13124 / NCTC 8237 / Type A' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium perfringens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 195103 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'modified pET26' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 GLN 100 100 100 GLN GLN A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 HIS 121 121 121 HIS HIS A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 HIS 125 125 125 HIS HIS A . n A 1 126 HIS 126 126 126 HIS HIS A . n # _cell.entry_id 2L57 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2L57 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L57 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L57 _struct.title 'Solution Structure of an Uncharacterized Thioredoin-like Protein from Clostridium perfringens' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L57 _struct_keywords.pdbx_keywords 'Structural genomics, Unknown function' _struct_keywords.text ;STRUCTURAL GENOMICS, UNKNOWN FUNCTION, THIOREDOXIN-LIKE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q0TMB4_CLOP1 _struct_ref.pdbx_db_accession Q0TMB4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EGIKQINFQSINVVENLEEAKEGIPTIIMFKTDTCPYCVEMQKELSYVSKEREGKFNIYYARLEEEKNIDLAYKYDANIV PTTVFLDKEGNKFYVHQGLMRKNNIETILNSLGVK ; _struct_ref.pdbx_align_begin 28 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L57 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 118 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q0TMB4 _struct_ref_seq.db_align_beg 28 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 118 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L57 MET A 1 ? UNP Q0TMB4 ? ? 'expression tag' 1 1 1 2L57 SER A 2 ? UNP Q0TMB4 ? ? 'expression tag' 2 2 1 2L57 LEU A 3 ? UNP Q0TMB4 ? ? 'expression tag' 3 3 1 2L57 GLU A 119 ? UNP Q0TMB4 ? ? 'expression tag' 119 4 1 2L57 GLY A 120 ? UNP Q0TMB4 ? ? 'expression tag' 120 5 1 2L57 HIS A 121 ? UNP Q0TMB4 ? ? 'expression tag' 121 6 1 2L57 HIS A 122 ? UNP Q0TMB4 ? ? 'expression tag' 122 7 1 2L57 HIS A 123 ? UNP Q0TMB4 ? ? 'expression tag' 123 8 1 2L57 HIS A 124 ? UNP Q0TMB4 ? ? 'expression tag' 124 9 1 2L57 HIS A 125 ? UNP Q0TMB4 ? ? 'expression tag' 125 10 1 2L57 HIS A 126 ? UNP Q0TMB4 ? ? 'expression tag' 126 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 38 ? ARG A 55 ? CYS A 38 ARG A 55 1 ? 18 HELX_P HELX_P2 2 GLU A 69 ? TYR A 78 ? GLU A 69 TYR A 78 1 ? 10 HELX_P HELX_P3 3 ARG A 104 ? GLY A 116 ? ARG A 104 GLY A 116 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 1 -0.15 2 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 2 -0.65 3 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 3 -0.92 4 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 4 -0.06 5 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 5 -1.35 6 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 6 -1.61 7 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 7 -0.82 8 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 8 -0.56 9 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 9 -0.56 10 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 10 -0.57 11 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 11 -1.91 12 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 12 -0.23 13 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 13 -0.68 14 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 14 -0.46 15 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 15 0.04 16 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 16 -1.99 17 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 17 -0.48 18 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 18 -0.89 19 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 19 -1.19 20 VAL 83 A . ? VAL 83 A PRO 84 A ? PRO 84 A 20 -0.62 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 16 ? VAL A 17 ? VAL A 16 VAL A 17 A 2 ASN A 60 ? ARG A 65 ? ASN A 60 ARG A 65 A 3 THR A 29 ? LYS A 34 ? THR A 29 LYS A 34 A 4 THR A 85 ? LEU A 89 ? THR A 85 LEU A 89 A 5 LYS A 95 ? GLN A 100 ? LYS A 95 GLN A 100 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 17 ? N VAL A 17 O ILE A 61 ? O ILE A 61 A 2 3 O ALA A 64 ? O ALA A 64 N LYS A 34 ? N LYS A 34 A 3 4 N ILE A 31 ? N ILE A 31 O VAL A 87 ? O VAL A 87 A 4 5 N THR A 86 ? N THR A 86 O HIS A 99 ? O HIS A 99 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.29 2 1 HB3 A PHE 88 ? ? HD13 A LEU 115 ? ? 1.33 3 1 OD2 A ASP 79 ? ? HZ2 A LYS 95 ? ? 1.52 4 1 HZ3 A LYS 105 ? ? OE1 A GLU 109 ? ? 1.54 5 1 HZ2 A LYS 34 ? ? OE2 A GLU 67 ? ? 1.57 6 1 HZ1 A LYS 53 ? ? OE1 A GLU 54 ? ? 1.58 7 2 HG3 A PRO 28 ? ? H A VAL 117 ? ? 1.28 8 2 HA2 A GLY 116 ? ? HZ2 A LYS 118 ? ? 1.30 9 2 HA A SER 2 ? ? HG3 A GLU 18 ? ? 1.33 10 2 HZ1 A LYS 53 ? ? OE2 A GLU 54 ? ? 1.57 11 2 H2 A MET 1 ? ? OE2 A GLU 22 ? ? 1.57 12 2 OE2 A GLU 56 ? ? HZ2 A LYS 58 ? ? 1.57 13 2 OE2 A GLU 4 ? ? HZ1 A LYS 7 ? ? 1.58 14 3 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.26 15 3 OD2 A ASP 79 ? ? HZ2 A LYS 95 ? ? 1.51 16 3 OE1 A GLU 43 ? ? HZ3 A LYS 46 ? ? 1.51 17 3 OE1 A GLU 119 ? ? HD1 A HIS 122 ? ? 1.57 18 3 OE2 A GLU 54 ? ? HH21 A ARG 55 ? ? 1.58 19 3 HZ2 A LYS 24 ? ? OE2 A GLU 25 ? ? 1.59 20 3 OE1 A GLU 18 ? ? HH22 A ARG 65 ? ? 1.59 21 4 OD2 A ASP 79 ? ? HZ2 A LYS 95 ? ? 1.52 22 4 HZ1 A LYS 24 ? ? OE1 A GLU 25 ? ? 1.52 23 4 H3 A MET 1 ? ? OE2 A GLU 4 ? ? 1.55 24 4 H2 A MET 1 ? ? OE2 A GLU 22 ? ? 1.57 25 4 OE1 A GLU 68 ? ? HZ1 A LYS 70 ? ? 1.58 26 4 HZ1 A LYS 91 ? ? OE2 A GLU 92 ? ? 1.58 27 4 OE2 A GLU 25 ? ? HE2 A HIS 121 ? ? 1.58 28 5 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.20 29 5 OE2 A GLU 43 ? ? HZ3 A LYS 46 ? ? 1.53 30 5 OD1 A ASP 90 ? ? HZ1 A LYS 91 ? ? 1.54 31 5 OD2 A ASP 73 ? ? HZ2 A LYS 77 ? ? 1.55 32 5 HD21 A ASN 19 ? ? OE1 A GLU 21 ? ? 1.56 33 5 OE1 A GLU 68 ? ? HZ1 A LYS 70 ? ? 1.57 34 5 OE2 A GLU 4 ? ? HZ2 A LYS 7 ? ? 1.58 35 5 HZ1 A LYS 24 ? ? OE2 A GLU 25 ? ? 1.60 36 5 OD1 A ASP 90 ? ? H A LYS 91 ? ? 1.60 37 6 OD2 A ASP 79 ? ? HZ3 A LYS 95 ? ? 1.52 38 6 HZ2 A LYS 105 ? ? OE1 A GLU 109 ? ? 1.53 39 6 HZ3 A LYS 7 ? ? OE2 A GLU 18 ? ? 1.54 40 6 OD2 A ASP 90 ? ? HZ2 A LYS 118 ? ? 1.54 41 6 HZ3 A LYS 91 ? ? OE2 A GLU 119 ? ? 1.56 42 6 OE1 A GLU 119 ? ? HD1 A HIS 122 ? ? 1.57 43 6 OE2 A GLU 43 ? ? HH12 A ARG 104 ? ? 1.59 44 7 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.35 45 7 HZ2 A LYS 105 ? ? OE2 A GLU 109 ? ? 1.56 46 7 OD1 A ASP 90 ? ? HZ2 A LYS 118 ? ? 1.58 47 7 HZ1 A LYS 7 ? ? OE2 A GLU 22 ? ? 1.58 48 7 OE1 A GLU 54 ? ? HZ3 A LYS 105 ? ? 1.59 49 8 OD2 A ASP 79 ? ? HZ3 A LYS 95 ? ? 1.52 50 8 OE1 A GLU 4 ? ? HZ3 A LYS 7 ? ? 1.53 51 8 OE2 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.58 52 8 OE1 A GLU 54 ? ? HZ1 A LYS 105 ? ? 1.59 53 8 OE1 A GLU 18 ? ? HH21 A ARG 65 ? ? 1.59 54 8 OE2 A GLU 18 ? ? HZ3 A LYS 70 ? ? 1.59 55 9 OE1 A GLU 43 ? ? HZ3 A LYS 46 ? ? 1.57 56 9 H1 A MET 1 ? ? OE2 A GLU 4 ? ? 1.57 57 9 HZ2 A LYS 24 ? ? OE2 A GLU 25 ? ? 1.58 58 10 H1 A MET 1 ? ? OE1 A GLU 69 ? ? 1.56 59 10 OD2 A ASP 73 ? ? HZ1 A LYS 77 ? ? 1.57 60 10 HZ1 A LYS 58 ? ? OE2 A GLU 119 ? ? 1.60 61 11 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.21 62 11 H1 A MET 1 ? ? OE2 A GLU 22 ? ? 1.56 63 11 HZ2 A LYS 53 ? ? OE2 A GLU 56 ? ? 1.57 64 11 HZ3 A LYS 105 ? ? OE2 A GLU 109 ? ? 1.58 65 11 OD2 A ASP 73 ? ? HZ2 A LYS 77 ? ? 1.58 66 12 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.09 67 12 HB3 A PHE 88 ? ? HD12 A LEU 115 ? ? 1.31 68 12 OE1 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.52 69 12 OD2 A ASP 79 ? ? HZ3 A LYS 95 ? ? 1.56 70 12 OD2 A ASP 73 ? ? HZ3 A LYS 77 ? ? 1.56 71 12 OE1 A GLU 68 ? ? HZ1 A LYS 70 ? ? 1.60 72 13 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.26 73 13 HE3 A LYS 34 ? ? HB3 A ARG 65 ? ? 1.28 74 13 OD2 A ASP 73 ? ? HZ1 A LYS 77 ? ? 1.55 75 13 OE1 A GLU 119 ? ? HD1 A HIS 122 ? ? 1.60 76 14 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.32 77 14 OD2 A ASP 79 ? ? HZ2 A LYS 95 ? ? 1.50 78 14 O A GLU 56 ? ? HZ1 A LYS 58 ? ? 1.55 79 14 OE2 A GLU 18 ? ? HZ1 A LYS 70 ? ? 1.57 80 14 HH12 A ARG 55 ? ? OE1 A GLU 109 ? ? 1.58 81 14 OE2 A GLU 68 ? ? HZ3 A LYS 70 ? ? 1.58 82 14 HD1 A HIS 124 ? ? OXT A HIS 126 ? ? 1.60 83 14 OE2 A GLU 92 ? ? HE2 A HIS 121 ? ? 1.60 84 14 OE2 A GLU 119 ? ? HE2 A HIS 122 ? ? 1.60 85 14 OE1 A GLU 25 ? ? HD1 A HIS 121 ? ? 1.60 86 15 HG2 A GLN 45 ? ? HH A TYR 63 ? ? 1.18 87 15 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.24 88 15 HZ3 A LYS 58 ? ? OE2 A GLU 119 ? ? 1.54 89 15 HZ2 A LYS 7 ? ? OE2 A GLU 18 ? ? 1.57 90 16 OE2 A GLU 54 ? ? HZ2 A LYS 105 ? ? 1.51 91 16 OE2 A GLU 56 ? ? HZ1 A LYS 58 ? ? 1.51 92 16 HH21 A ARG 55 ? ? OE1 A GLU 109 ? ? 1.58 93 16 HZ2 A LYS 7 ? ? OE2 A GLU 18 ? ? 1.59 94 17 HG2 A PRO 28 ? ? HA A VAL 117 ? ? 1.09 95 17 HZ2 A LYS 7 ? ? OE1 A GLU 22 ? ? 1.55 96 18 OE1 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.53 97 18 HZ2 A LYS 34 ? ? OE2 A GLU 67 ? ? 1.53 98 18 H1 A MET 1 ? ? OE1 A GLU 4 ? ? 1.55 99 18 HZ1 A LYS 7 ? ? OE1 A GLU 18 ? ? 1.57 100 19 OD2 A ASP 79 ? ? HZ2 A LYS 95 ? ? 1.55 101 19 OE1 A GLU 68 ? ? HZ2 A LYS 70 ? ? 1.55 102 19 HD21 A ASN 19 ? ? OE1 A GLU 21 ? ? 1.58 103 19 HZ1 A LYS 53 ? ? OE2 A GLU 56 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 4 ? ? 66.34 -64.46 2 1 LYS A 7 ? ? -162.69 35.50 3 1 GLN A 8 ? ? -140.85 25.93 4 1 GLN A 12 ? ? 156.78 -18.24 5 1 ASP A 36 ? ? -49.68 -74.55 6 1 LYS A 58 ? ? -144.14 -36.73 7 1 ASP A 90 ? ? -75.15 -164.48 8 2 LEU A 3 ? ? -57.00 -71.39 9 2 LYS A 7 ? ? 72.76 -63.69 10 2 ILE A 9 ? ? -112.67 -159.15 11 2 PHE A 11 ? ? 72.78 -175.73 12 2 GLN A 12 ? ? 69.13 -61.20 13 2 ARG A 55 ? ? -111.96 74.55 14 2 LEU A 66 ? ? -69.75 11.20 15 2 LEU A 115 ? ? -91.12 -64.97 16 2 LYS A 118 ? ? -107.56 59.51 17 2 GLU A 119 ? ? -119.70 -86.40 18 2 HIS A 123 ? ? 70.17 -56.40 19 3 SER A 2 ? ? -150.90 -51.74 20 3 LEU A 3 ? ? -110.47 -153.95 21 3 ILE A 6 ? ? 170.28 -19.73 22 3 LYS A 7 ? ? 80.16 103.68 23 3 GLN A 8 ? ? 65.24 89.45 24 3 ILE A 14 ? ? -108.41 -61.21 25 3 ASN A 15 ? ? -85.25 30.18 26 3 CYS A 38 ? ? 74.61 106.02 27 3 ASN A 81 ? ? -151.76 -40.20 28 3 ASP A 90 ? ? -69.80 -172.67 29 3 VAL A 117 ? ? -43.14 100.09 30 3 LYS A 118 ? ? 169.66 -178.40 31 3 HIS A 122 ? ? -64.01 88.00 32 3 HIS A 123 ? ? -158.85 36.51 33 3 HIS A 125 ? ? -154.57 -35.84 34 4 SER A 2 ? ? -153.76 69.94 35 4 LEU A 3 ? ? 64.67 79.90 36 4 LYS A 7 ? ? 72.13 -61.39 37 4 ILE A 9 ? ? -176.27 128.35 38 4 ASN A 10 ? ? -166.24 -71.29 39 4 GLN A 12 ? ? 171.50 -67.64 40 4 ILE A 14 ? ? 70.96 -60.10 41 4 ASN A 15 ? ? -83.30 30.40 42 4 LYS A 24 ? ? -173.86 -168.95 43 4 GLU A 25 ? ? 75.55 -170.72 44 4 THR A 35 ? ? -67.72 -173.09 45 4 THR A 37 ? ? -137.96 -98.02 46 4 CYS A 38 ? ? 65.71 130.13 47 4 ARG A 55 ? ? -153.00 88.93 48 4 LEU A 115 ? ? -93.47 -66.72 49 4 HIS A 122 ? ? 72.24 -56.96 50 4 HIS A 123 ? ? -120.97 -93.97 51 4 HIS A 124 ? ? 174.50 -58.42 52 4 HIS A 125 ? ? -159.97 -66.12 53 5 GLU A 4 ? ? -83.14 -82.16 54 5 GLN A 8 ? ? -129.61 -166.73 55 5 GLN A 12 ? ? -47.77 -71.48 56 5 ILE A 14 ? ? 74.00 -63.86 57 5 ASN A 15 ? ? -87.83 32.08 58 5 LYS A 24 ? ? -172.41 -171.07 59 5 GLU A 25 ? ? 72.26 -174.01 60 5 CYS A 38 ? ? -169.46 113.44 61 5 LEU A 115 ? ? -78.38 -81.91 62 5 VAL A 117 ? ? 50.42 78.23 63 6 SER A 2 ? ? -177.32 119.81 64 6 LEU A 3 ? ? 57.16 78.37 65 6 LYS A 7 ? ? -69.63 27.73 66 6 SER A 13 ? ? 67.94 88.48 67 6 LYS A 24 ? ? -167.21 90.77 68 6 ARG A 55 ? ? -156.76 85.49 69 6 LYS A 95 ? ? -68.19 85.38 70 6 LEU A 115 ? ? -85.17 -73.98 71 6 HIS A 121 ? ? -149.40 22.79 72 6 HIS A 125 ? ? -126.72 -57.52 73 7 GLU A 4 ? ? 60.76 -167.25 74 7 ILE A 6 ? ? -135.99 -40.27 75 7 LYS A 7 ? ? -160.11 -71.28 76 7 PHE A 11 ? ? -96.49 -148.72 77 7 GLN A 12 ? ? 76.64 -63.76 78 7 ILE A 14 ? ? 69.06 -68.80 79 7 ASN A 19 ? ? -172.60 -178.85 80 7 ARG A 55 ? ? -158.07 75.70 81 7 LEU A 66 ? ? -66.36 11.58 82 7 ASP A 90 ? ? -71.25 -165.46 83 7 LEU A 115 ? ? -67.78 -78.49 84 7 LYS A 118 ? ? -77.68 -139.01 85 7 GLU A 119 ? ? 81.62 146.86 86 7 HIS A 122 ? ? -138.08 -49.59 87 7 HIS A 125 ? ? -121.71 -70.94 88 8 SER A 2 ? ? 67.79 98.69 89 8 LEU A 3 ? ? -163.11 17.76 90 8 GLN A 8 ? ? -104.51 42.15 91 8 ASN A 10 ? ? 69.03 97.64 92 8 GLN A 12 ? ? -167.26 -64.34 93 8 ILE A 14 ? ? 71.19 141.89 94 8 GLU A 25 ? ? 81.94 164.95 95 8 ASP A 36 ? ? -60.92 -80.62 96 8 ARG A 55 ? ? -156.36 79.23 97 8 ASN A 81 ? ? -133.63 -40.22 98 8 GLU A 119 ? ? -50.69 -73.09 99 8 HIS A 123 ? ? -165.54 114.70 100 9 LEU A 3 ? ? 65.05 87.33 101 9 ILE A 6 ? ? -138.37 -32.36 102 9 LYS A 7 ? ? -85.77 41.78 103 9 GLN A 12 ? ? 168.63 -61.69 104 9 ILE A 14 ? ? 70.96 -69.49 105 9 ASN A 15 ? ? -83.17 31.91 106 9 LEU A 66 ? ? -67.14 12.25 107 9 LEU A 115 ? ? -70.70 -71.38 108 9 VAL A 117 ? ? 51.71 73.87 109 9 HIS A 121 ? ? -53.81 105.95 110 9 HIS A 122 ? ? -74.41 -169.43 111 9 HIS A 123 ? ? -68.00 85.93 112 10 GLU A 4 ? ? -106.46 -74.53 113 10 ILE A 6 ? ? -122.33 -162.99 114 10 LYS A 7 ? ? 72.53 -69.96 115 10 ASN A 10 ? ? 179.64 -37.88 116 10 PHE A 11 ? ? -141.68 -158.58 117 10 GLN A 12 ? ? 75.30 -50.99 118 10 ILE A 14 ? ? 69.42 -74.23 119 10 GLU A 25 ? ? 66.59 167.61 120 10 ARG A 55 ? ? -161.23 76.63 121 10 GLU A 69 ? ? 69.23 -36.62 122 10 MET A 103 ? ? 64.18 175.73 123 10 LEU A 115 ? ? -66.25 -70.34 124 10 HIS A 123 ? ? 178.66 170.58 125 10 HIS A 124 ? ? -99.42 -151.59 126 11 LYS A 7 ? ? -68.22 99.87 127 11 GLN A 12 ? ? 72.94 -63.73 128 11 ILE A 14 ? ? -93.22 -65.30 129 11 THR A 37 ? ? 73.51 89.44 130 11 LEU A 66 ? ? -67.92 10.95 131 11 LEU A 115 ? ? -57.13 -72.95 132 11 VAL A 117 ? ? 53.04 71.46 133 11 HIS A 124 ? ? 61.31 -87.11 134 11 HIS A 125 ? ? -161.50 16.54 135 12 ILE A 6 ? ? -135.74 -55.26 136 12 ILE A 9 ? ? -135.49 -36.97 137 12 ASN A 10 ? ? 66.90 -139.91 138 12 GLN A 12 ? ? 70.85 -2.93 139 12 SER A 13 ? ? -140.80 -86.99 140 12 ILE A 14 ? ? 69.52 -78.24 141 12 ARG A 55 ? ? -151.38 76.90 142 12 PHE A 59 ? ? -170.79 136.49 143 12 LEU A 115 ? ? -81.28 -73.62 144 12 VAL A 117 ? ? 52.85 73.54 145 12 HIS A 122 ? ? 39.50 85.34 146 12 HIS A 124 ? ? -150.90 13.36 147 13 GLU A 4 ? ? -80.65 -90.26 148 13 LYS A 7 ? ? 72.60 -46.21 149 13 PHE A 11 ? ? 57.92 -17.74 150 13 SER A 13 ? ? 78.57 134.45 151 13 CYS A 38 ? ? -160.13 101.68 152 13 LEU A 66 ? ? -63.70 11.71 153 13 ASN A 81 ? ? -158.45 -36.97 154 13 LEU A 115 ? ? -85.01 -86.62 155 13 HIS A 121 ? ? 163.54 76.37 156 13 HIS A 123 ? ? 71.79 90.99 157 13 HIS A 124 ? ? 64.84 104.42 158 14 GLU A 4 ? ? -90.34 33.55 159 14 ILE A 6 ? ? -176.42 128.09 160 14 GLN A 8 ? ? 56.11 95.55 161 14 ASN A 10 ? ? 71.37 118.08 162 14 LEU A 66 ? ? -65.87 10.50 163 14 ASN A 81 ? ? -146.16 -34.16 164 14 LEU A 115 ? ? -93.11 -73.92 165 14 VAL A 117 ? ? 50.33 78.18 166 14 HIS A 124 ? ? 67.38 158.59 167 15 GLN A 8 ? ? 65.45 107.67 168 15 ILE A 9 ? ? -157.03 16.31 169 15 GLN A 12 ? ? -127.57 -53.40 170 15 ILE A 14 ? ? 70.33 -69.11 171 15 ASN A 15 ? ? -92.93 31.28 172 15 GLU A 25 ? ? 61.80 -170.36 173 15 ARG A 55 ? ? -114.80 79.03 174 15 LEU A 66 ? ? -66.73 10.51 175 15 ASN A 81 ? ? -144.33 -75.55 176 15 LEU A 115 ? ? -87.52 -88.18 177 16 LYS A 7 ? ? 71.46 -53.29 178 16 ASN A 10 ? ? 71.37 -80.36 179 16 PHE A 11 ? ? -175.07 -166.46 180 16 GLN A 12 ? ? 80.97 -45.70 181 16 PHE A 59 ? ? -171.79 141.93 182 16 LEU A 66 ? ? -64.57 11.43 183 16 PHE A 96 ? ? -104.35 -72.53 184 16 VAL A 117 ? ? 54.97 72.15 185 16 GLU A 119 ? ? -175.30 138.47 186 16 HIS A 124 ? ? -101.71 61.26 187 17 SER A 2 ? ? -151.90 20.13 188 17 LEU A 3 ? ? -161.42 83.70 189 17 ILE A 6 ? ? -154.79 -48.04 190 17 GLN A 12 ? ? -128.60 -68.78 191 17 LEU A 66 ? ? -65.42 10.74 192 17 ASN A 81 ? ? -154.58 -35.01 193 17 VAL A 117 ? ? -33.86 107.97 194 17 LYS A 118 ? ? 176.40 -172.89 195 17 HIS A 123 ? ? -131.33 -47.94 196 18 SER A 2 ? ? 72.85 -58.10 197 18 ILE A 6 ? ? -146.91 -50.54 198 18 ILE A 14 ? ? 64.59 -68.36 199 18 ASN A 15 ? ? -89.15 45.82 200 18 ASP A 36 ? ? -54.12 -75.36 201 18 LYS A 58 ? ? 53.58 8.33 202 18 PHE A 59 ? ? -163.21 114.14 203 18 LEU A 66 ? ? -66.64 10.24 204 18 VAL A 117 ? ? 52.43 81.55 205 18 LYS A 118 ? ? -165.83 -165.36 206 18 GLU A 119 ? ? 80.38 153.15 207 19 GLU A 4 ? ? -94.85 -74.89 208 19 GLN A 8 ? ? -76.54 29.86 209 19 SER A 13 ? ? -122.80 -92.15 210 19 ILE A 14 ? ? 70.81 -74.61 211 19 GLU A 25 ? ? 60.29 -164.11 212 19 LEU A 66 ? ? -64.15 12.00 213 19 ASN A 81 ? ? -141.25 -81.15 214 19 VAL A 117 ? ? 50.42 75.06 215 20 PHE A 11 ? ? 66.86 177.16 216 20 GLN A 12 ? ? 68.81 -50.60 217 20 SER A 13 ? ? -67.81 92.62 218 20 GLU A 25 ? ? 58.13 -166.12 219 20 PHE A 59 ? ? -176.03 138.31 220 20 LEU A 115 ? ? -57.94 -70.93 221 20 VAL A 117 ? ? 55.72 76.80 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'New York SGX Research Center for Structural Genomics' 1 NYSGXRC 'PSI, Protein Structure Initiative' 'New York Structural Genomics Research Consortium' 2 NYSGRC PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L57 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L57 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-100% 13C; U-100% 15N] uncharacterized thioredoxin-like protein, 20 mM sodium phosphate, 1 mM DTT, 50 mM sodium chloride, 90% H2O, 10% D2O ; 1 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] uncharacterized thioredoxin-like protein, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'uncharacterized thiredoxin-like protein-1' 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 DTT-3 1 ? mM ? 1 'sodium chloride-4' 50 ? mM ? 1 'uncharacterized thiredoxin-like protein-5' 1 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate-6' 20 ? mM ? 2 'sodium chloride-7' 50 ? mM ? 2 DTT-8 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C HSQC' 1 4 2 'aromatic 13C HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L57 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 74 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1857 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 366 _pdbx_nmr_constraints.NOE_long_range_total_count 643 _pdbx_nmr_constraints.NOE_medium_range_total_count 402 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 403 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 69 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 69 # _pdbx_nmr_refine.entry_id 2L57 _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 600 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2L57 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_