data_2L59 # _entry.id 2L59 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L59 RCSB RCSB101973 WWPDB D_1000101973 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2L4Q _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L59 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-10-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Olson, A.L.' 1 'Cai, S.' 2 'Sem, D.S.' 3 # _citation.id primary _citation.title ;Solution structures of Mycobacterium tuberculosis thioredoxin C and models of intact thioredoxin system suggest new approaches to inhibitor and drug design. ; _citation.journal_abbrev Proteins _citation.journal_volume 81 _citation.page_first 675 _citation.page_last 689 _citation.year 2013 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23229911 _citation.pdbx_database_id_DOI 10.1002/prot.24228 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Olson, A.L.' 1 primary 'Neumann, T.S.' 2 primary 'Cai, S.' 3 primary 'Sem, D.S.' 4 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 12557.433 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Trx, MPT46' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN ; _entity_poly.pdbx_seq_one_letter_code_can ;MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ASP n 1 4 SER n 1 5 GLU n 1 6 LYS n 1 7 SER n 1 8 ALA n 1 9 THR n 1 10 ILE n 1 11 LYS n 1 12 VAL n 1 13 THR n 1 14 ASP n 1 15 ALA n 1 16 SER n 1 17 PHE n 1 18 ALA n 1 19 THR n 1 20 ASP n 1 21 VAL n 1 22 LEU n 1 23 SER n 1 24 SER n 1 25 ASN n 1 26 LYS n 1 27 PRO n 1 28 VAL n 1 29 LEU n 1 30 VAL n 1 31 ASP n 1 32 PHE n 1 33 TRP n 1 34 ALA n 1 35 THR n 1 36 TRP n 1 37 CYS n 1 38 GLY n 1 39 PRO n 1 40 CYS n 1 41 LYS n 1 42 MET n 1 43 VAL n 1 44 ALA n 1 45 PRO n 1 46 VAL n 1 47 LEU n 1 48 GLU n 1 49 GLU n 1 50 ILE n 1 51 ALA n 1 52 THR n 1 53 GLU n 1 54 ARG n 1 55 ALA n 1 56 THR n 1 57 ASP n 1 58 LEU n 1 59 THR n 1 60 VAL n 1 61 ALA n 1 62 LYS n 1 63 LEU n 1 64 ASP n 1 65 VAL n 1 66 ASP n 1 67 THR n 1 68 ASN n 1 69 PRO n 1 70 GLU n 1 71 THR n 1 72 ALA n 1 73 ARG n 1 74 ASN n 1 75 PHE n 1 76 GLN n 1 77 VAL n 1 78 VAL n 1 79 SER n 1 80 ILE n 1 81 PRO n 1 82 THR n 1 83 LEU n 1 84 ILE n 1 85 LEU n 1 86 PHE n 1 87 LYS n 1 88 ASP n 1 89 GLY n 1 90 GLN n 1 91 PRO n 1 92 VAL n 1 93 LYS n 1 94 ARG n 1 95 ILE n 1 96 VAL n 1 97 GLY n 1 98 ALA n 1 99 LYS n 1 100 GLY n 1 101 LYS n 1 102 ALA n 1 103 ALA n 1 104 LEU n 1 105 LEU n 1 106 ARG n 1 107 GLU n 1 108 LEU n 1 109 SER n 1 110 ASP n 1 111 VAL n 1 112 VAL n 1 113 PRO n 1 114 ASN n 1 115 LEU n 1 116 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'trxA, trx, trxC, Rv3914, MT4033, MTV028.05' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET-23b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code THIO_MYCTU _struct_ref.pdbx_db_accession P0A616 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L59 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0A616 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D C(CO)NH' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HBHA(CO)NH' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298.4 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '50 mM potassium phosphate-1, 1.2 mM [U-13C, U-15N] Thioredoxin, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L59 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L59 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L59 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement AMBER ? 2 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 3 Goddard 'data analysis' SPARKY ? 4 Goddard 'chemical shift assignment' SPARKY ? 5 Goddard 'peak picking' SPARKY ? 6 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L59 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L59 _struct.title 'Solution Structures of Oxidized and Reduced Thioredoxin C from M. tb' _struct.pdbx_descriptor Thioredoxin _struct.pdbx_model_details 'closest to the average, model 16' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L59 _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text 'Trx, M. tb, Tuberculosis, TrxC, OXIDOREDUCTASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 16 ? VAL A 21 ? SER A 16 VAL A 21 1 ? 6 HELX_P HELX_P2 2 CYS A 37 ? ARG A 54 ? CYS A 37 ARG A 54 1 ? 18 HELX_P HELX_P3 3 ASN A 68 ? PHE A 75 ? ASN A 68 PHE A 75 1 ? 8 HELX_P HELX_P4 4 GLY A 100 ? ASP A 110 ? GLY A 100 ASP A 110 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 37 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 40 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 40 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.043 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 8 A . ? ALA 8 A THR 9 A ? THR 9 A 1 -4.07 2 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 1 -2.80 3 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 2 -11.90 4 THR 2 A . ? THR 2 A ASP 3 A ? ASP 3 A 3 -8.86 5 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 3 -13.08 6 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 4 0.90 7 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 5 -8.17 8 VAL 112 A . ? VAL 112 A PRO 113 A ? PRO 113 A 5 -7.79 9 LYS 6 A . ? LYS 6 A SER 7 A ? SER 7 A 6 17.77 10 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 6 -5.84 11 SER 7 A . ? SER 7 A ALA 8 A ? ALA 8 A 7 -13.18 12 VAL 78 A . ? VAL 78 A SER 79 A ? SER 79 A 7 -9.71 13 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 7 -11.33 14 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 8 -5.07 15 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 9 -8.23 16 VAL 112 A . ? VAL 112 A PRO 113 A ? PRO 113 A 9 0.46 17 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 10 1.24 18 VAL 112 A . ? VAL 112 A PRO 113 A ? PRO 113 A 10 0.83 19 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 11 -8.19 20 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 12 -0.79 21 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 13 -9.66 22 THR 2 A . ? THR 2 A ASP 3 A ? ASP 3 A 14 0.54 23 SER 7 A . ? SER 7 A ALA 8 A ? ALA 8 A 14 -11.39 24 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 14 0.17 25 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 15 -6.45 26 SER 24 A . ? SER 24 A ASN 25 A ? ASN 25 A 16 -1.70 27 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 16 -6.80 28 GLU 5 A . ? GLU 5 A LYS 6 A ? LYS 6 A 17 19.23 29 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 17 -11.10 30 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 18 -4.82 31 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 19 -7.18 32 ILE 80 A . ? ILE 80 A PRO 81 A ? PRO 81 A 20 -0.41 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 10 ? LYS A 11 ? ILE A 10 LYS A 11 A 2 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 A 3 PRO A 27 ? TRP A 33 ? PRO A 27 TRP A 33 A 4 THR A 82 ? LYS A 87 ? THR A 82 LYS A 87 A 5 GLN A 90 ? VAL A 96 ? GLN A 90 VAL A 96 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 10 ? N ILE A 10 O VAL A 60 ? O VAL A 60 A 2 3 O ALA A 61 ? O ALA A 61 N LEU A 29 ? N LEU A 29 A 3 4 N PHE A 32 ? N PHE A 32 O THR A 82 ? O THR A 82 A 4 5 N LEU A 85 ? N LEU A 85 O VAL A 92 ? O VAL A 92 # _atom_sites.entry_id 2L59 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 MET 42 42 42 MET MET A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ARG 73 73 73 ARG ARG A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ARG 94 94 94 ARG ARG A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 ASP 110 110 110 ASP ASP A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 ASN 114 114 114 ASN ASN A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASN 116 116 116 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-26 2 'Structure model' 1 1 2012-12-19 3 'Structure model' 1 2 2013-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'potassium phosphate-1' 50 ? mM ? 1 Thioredoxin 1.2 ? mM '[U-13C; U-15N]' 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.98 120.30 3.68 0.50 N 2 1 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.61 120.30 3.31 0.50 N 3 2 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 123.72 120.30 3.42 0.50 N 4 3 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.79 120.30 3.49 0.50 N 5 4 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.37 120.30 3.07 0.50 N 6 4 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.35 120.30 3.05 0.50 N 7 5 NE A ARG 94 ? ? CZ A ARG 94 ? ? NH1 A ARG 94 ? ? 123.34 120.30 3.04 0.50 N 8 6 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.40 120.30 3.10 0.50 N 9 7 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.71 120.30 3.41 0.50 N 10 7 NE A ARG 73 ? ? CZ A ARG 73 ? ? NH1 A ARG 73 ? ? 123.57 120.30 3.27 0.50 N 11 9 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.34 120.30 3.04 0.50 N 12 15 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 123.31 120.30 3.01 0.50 N 13 16 NE A ARG 54 ? ? CZ A ARG 54 ? ? NH1 A ARG 54 ? ? 124.63 120.30 4.33 0.50 N 14 19 NE A ARG 106 ? ? CZ A ARG 106 ? ? NH1 A ARG 106 ? ? 124.09 120.30 3.79 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 78 ? ? -137.86 -40.44 2 1 ASN A 114 ? ? -161.65 -57.17 3 2 LEU A 115 ? ? -144.46 -7.72 4 3 VAL A 96 ? ? -88.39 36.74 5 4 ASP A 3 ? ? -84.96 35.68 6 4 GLU A 5 ? ? 60.43 -62.00 7 4 LYS A 6 ? ? 57.79 -2.85 8 4 VAL A 96 ? ? -96.09 41.04 9 5 ASN A 25 ? ? 48.01 21.60 10 5 LEU A 115 ? ? 63.06 -41.33 11 6 LYS A 6 ? ? 52.45 86.86 12 7 LEU A 115 ? ? -81.73 48.72 13 8 LYS A 6 ? ? 62.79 169.57 14 9 GLU A 5 ? ? -141.11 33.66 15 9 ASP A 88 ? ? -149.92 53.82 16 10 SER A 4 ? ? 53.92 19.72 17 11 SER A 4 ? ? -158.28 -47.12 18 11 PRO A 113 ? ? -77.76 39.96 19 13 ASP A 3 ? ? 52.09 -102.31 20 13 ALA A 34 ? ? -129.88 -167.54 21 14 SER A 4 ? ? -78.29 44.72 22 14 ALA A 8 ? ? -146.04 12.75 23 14 VAL A 78 ? ? -130.21 -48.49 24 14 VAL A 96 ? ? -97.93 36.41 25 16 SER A 24 ? ? 52.89 -138.90 26 17 ALA A 8 ? ? -91.24 55.65 27 18 SER A 4 ? ? 57.71 16.04 28 18 ASN A 68 ? ? -142.51 59.51 29 19 GLU A 5 ? ? -82.15 43.07 30 19 LEU A 115 ? ? 59.38 15.03 31 20 ASP A 3 ? ? 61.30 -53.13 32 20 ALA A 8 ? ? -87.86 36.83 33 20 VAL A 78 ? ? -134.55 -61.51 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 LYS A 26 ? ? PRO A 27 ? ? 147.55 2 19 TRP A 33 ? ? ALA A 34 ? ? 142.62 #