data_2L5L # _entry.id 2L5L # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L5L pdb_00002l5l 10.2210/pdb2l5l/pdb RCSB RCSB101985 ? ? BMRB 17275 ? 10.13018/BMR17275 WWPDB D_1000101985 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-11-24 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-05-08 4 'Structure model' 1 3 2018-11-14 5 'Structure model' 1 4 2021-02-10 6 'Structure model' 1 5 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Structure summary' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 5 'Structure model' audit_author 3 5 'Structure model' citation_author 4 5 'Structure model' struct_ref_seq_dif 5 6 'Structure model' chem_comp_atom 6 6 'Structure model' chem_comp_bond 7 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 5 'Structure model' '_audit_author.identifier_ORCID' 3 5 'Structure model' '_citation_author.identifier_ORCID' 4 5 'Structure model' '_struct_ref_seq_dif.details' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L5L _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-02 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGXRC-11218b TargetDB . unspecified 17275 BMRB . unspecified NYSGRC-011324 TargetTrack . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Harris, R.' 1 ? 'Foti, R.' 2 ? 'Seidel, R.D.' 3 ? 'Bonanno, J.B.' 4 ? 'Freeman, J.' 5 ? 'Bain, K.T.' 6 ? 'Sauder, J.M.' 7 0000-0002-0254-4955 'Burley, S.K.' 8 0000-0002-2487-9713 'Girvin, M.E.' 9 ? 'Almo, S.C.' 10 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ? 'New York Structural Genomics Research Consortium (NYSGRC)' 12 ? # _citation.id primary _citation.title 'Solution Structure of Thioredoxin from Bacteroides Vulgatus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Foti, R.' 2 ? primary 'Seidel, R.D.' 3 ? primary 'Bonanno, J.B.' 4 ? primary 'Freeman, J.' 5 ? primary 'Bain, K.T.' 6 ? primary 'Sauder, J.M.' 7 ? primary 'Burley, S.K.' 8 0000-0002-2487-9713 primary 'Girvin, M.E.' 9 ? primary 'Almo, S.C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Thioredoxin _entity.formula_weight 15426.753 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEK EQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEK EQELAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLKKEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 'NYSGXRC-11218b, NYSGRC-011324' # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 ALA n 1 5 THR n 1 6 GLU n 1 7 GLY n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 VAL n 1 12 ILE n 1 13 HIS n 1 14 LEU n 1 15 THR n 1 16 LYS n 1 17 ALA n 1 18 GLU n 1 19 PHE n 1 20 LEU n 1 21 ALA n 1 22 LYS n 1 23 VAL n 1 24 TYR n 1 25 ASN n 1 26 PHE n 1 27 GLU n 1 28 LYS n 1 29 ASN n 1 30 PRO n 1 31 GLU n 1 32 GLU n 1 33 TRP n 1 34 LYS n 1 35 TYR n 1 36 GLU n 1 37 GLY n 1 38 ASP n 1 39 LYS n 1 40 PRO n 1 41 ALA n 1 42 ILE n 1 43 VAL n 1 44 ASP n 1 45 PHE n 1 46 TYR n 1 47 ALA n 1 48 ASP n 1 49 TRP n 1 50 CYS n 1 51 GLY n 1 52 PRO n 1 53 CYS n 1 54 LYS n 1 55 MET n 1 56 VAL n 1 57 ALA n 1 58 PRO n 1 59 ILE n 1 60 LEU n 1 61 ASP n 1 62 GLU n 1 63 LEU n 1 64 ALA n 1 65 LYS n 1 66 GLU n 1 67 TYR n 1 68 ASP n 1 69 GLY n 1 70 GLN n 1 71 ILE n 1 72 VAL n 1 73 ILE n 1 74 TYR n 1 75 LYS n 1 76 VAL n 1 77 ASP n 1 78 THR n 1 79 GLU n 1 80 LYS n 1 81 GLU n 1 82 GLN n 1 83 GLU n 1 84 LEU n 1 85 ALA n 1 86 GLY n 1 87 ALA n 1 88 PHE n 1 89 GLY n 1 90 ILE n 1 91 ARG n 1 92 SER n 1 93 ILE n 1 94 PRO n 1 95 SER n 1 96 ILE n 1 97 LEU n 1 98 PHE n 1 99 ILE n 1 100 PRO n 1 101 MET n 1 102 GLU n 1 103 GLY n 1 104 LYS n 1 105 PRO n 1 106 GLU n 1 107 MET n 1 108 ALA n 1 109 GLN n 1 110 GLY n 1 111 ALA n 1 112 MET n 1 113 PRO n 1 114 LYS n 1 115 ALA n 1 116 SER n 1 117 PHE n 1 118 LYS n 1 119 LYS n 1 120 ALA n 1 121 ILE n 1 122 ASP n 1 123 GLU n 1 124 PHE n 1 125 LEU n 1 126 LEU n 1 127 LYS n 1 128 LYS n 1 129 GLU n 1 130 GLY n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n 1 135 HIS n 1 136 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BVU_1309 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 8482 / DSM 1447 / NCTC 11154' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacteroides vulgatus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 435590 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'modified pET26' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 PRO 100 100 100 PRO PRO A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 MET 107 107 107 MET MET A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 PHE 117 117 117 PHE PHE A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 PHE 124 124 124 PHE PHE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLU 129 129 129 GLU GLU A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 134 HIS HIS A . n A 1 135 HIS 135 135 135 HIS HIS A . n A 1 136 HIS 136 136 136 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L5L _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L5L _struct.title 'Solution Structure of Thioredoxin from Bacteroides Vulgatus' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L5L _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' _struct_keywords.text ;STRUCTURAL GENOMICS, ELECTRON TRANSPORT, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, New York Structural Genomics Research Consortium, NYSGRC, PSI-Biology, TRANSPORT PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A6KZY4_BACV8 _struct_ref.pdbx_db_accession A6KZY4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ATEGNGKVIHLTKAEFLAKVYNFEKNPEEWKYEGDKPAIVDFYADWCGPCKMVAPILDELAKEYDGQIVIYKVDTEKEQE LAGAFGIRSIPSILFIPMEGKPEMAQGAMPKASFKKAIDEFLLKK ; _struct_ref.pdbx_align_begin 35 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L5L _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A6KZY4 _struct_ref_seq.db_align_beg 35 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 159 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L5L MET A 1 ? UNP A6KZY4 ? ? 'expression tag' 1 1 1 2L5L SER A 2 ? UNP A6KZY4 ? ? 'expression tag' 2 2 1 2L5L LEU A 3 ? UNP A6KZY4 ? ? 'expression tag' 3 3 1 2L5L GLU A 129 ? UNP A6KZY4 ? ? 'expression tag' 129 4 1 2L5L GLY A 130 ? UNP A6KZY4 ? ? 'expression tag' 130 5 1 2L5L HIS A 131 ? UNP A6KZY4 ? ? 'expression tag' 131 6 1 2L5L HIS A 132 ? UNP A6KZY4 ? ? 'expression tag' 132 7 1 2L5L HIS A 133 ? UNP A6KZY4 ? ? 'expression tag' 133 8 1 2L5L HIS A 134 ? UNP A6KZY4 ? ? 'expression tag' 134 9 1 2L5L HIS A 135 ? UNP A6KZY4 ? ? 'expression tag' 135 10 1 2L5L HIS A 136 ? UNP A6KZY4 ? ? 'expression tag' 136 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 15 ? VAL A 23 ? THR A 15 VAL A 23 1 ? 9 HELX_P HELX_P2 2 CYS A 50 ? TYR A 67 ? CYS A 50 TYR A 67 1 ? 18 HELX_P HELX_P3 3 GLU A 81 ? PHE A 88 ? GLU A 81 PHE A 88 1 ? 8 HELX_P HELX_P4 4 PRO A 113 ? LEU A 126 ? PRO A 113 LEU A 126 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 1 -5.00 2 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 2 -6.24 3 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 3 -3.61 4 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 4 -3.78 5 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 5 -3.53 6 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 6 -3.82 7 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 7 -4.25 8 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 8 -2.30 9 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 9 -3.66 10 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 10 -3.22 11 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 11 -2.82 12 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 12 -2.35 13 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 13 -3.74 14 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 14 -5.71 15 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 15 -3.85 16 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 16 -3.05 17 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 17 -3.61 18 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 18 -4.87 19 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 19 -2.59 20 ILE 93 A . ? ILE 93 A PRO 94 A ? PRO 94 A 20 -4.33 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 11 ? LEU A 14 ? VAL A 11 LEU A 14 A 2 VAL A 72 ? ASP A 77 ? VAL A 72 ASP A 77 A 3 ALA A 41 ? TYR A 46 ? ALA A 41 TYR A 46 A 4 SER A 95 ? ILE A 99 ? SER A 95 ILE A 99 A 5 GLU A 106 ? GLN A 109 ? GLU A 106 GLN A 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 14 ? N LEU A 14 O LYS A 75 ? O LYS A 75 A 2 3 O TYR A 74 ? O TYR A 74 N ILE A 42 ? N ILE A 42 A 3 4 N PHE A 45 ? N PHE A 45 O SER A 95 ? O SER A 95 A 4 5 N PHE A 98 ? N PHE A 98 O GLU A 106 ? O GLU A 106 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 44 ? ? HZ2 A LYS 75 ? ? 1.51 2 1 OE1 A GLU 62 ? ? HZ1 A LYS 65 ? ? 1.52 3 1 OE1 A GLU 102 ? ? HZ1 A LYS 128 ? ? 1.57 4 1 HZ3 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.57 5 1 OE2 A GLU 102 ? ? HD1 A HIS 132 ? ? 1.60 6 2 OD1 A ASP 44 ? ? HZ2 A LYS 75 ? ? 1.53 7 2 OE1 A GLU 66 ? ? HZ2 A LYS 114 ? ? 1.54 8 2 HZ3 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.57 9 2 OE1 A GLU 102 ? ? HZ2 A LYS 128 ? ? 1.57 10 2 HZ3 A LYS 119 ? ? OE2 A GLU 123 ? ? 1.57 11 2 HH A TYR 67 ? ? OD1 A ASP 122 ? ? 1.59 12 2 HZ3 A LYS 127 ? ? OE2 A GLU 129 ? ? 1.59 13 2 OE2 A GLU 66 ? ? HZ3 A LYS 118 ? ? 1.59 14 2 OD2 A ASP 77 ? ? HZ2 A LYS 80 ? ? 1.60 15 3 HZ2 A LYS 118 ? ? HB2 A ASP 122 ? ? 1.34 16 3 OE2 A GLU 62 ? ? HZ2 A LYS 65 ? ? 1.57 17 4 HG3 A GLU 62 ? ? HZ2 A LYS 114 ? ? 1.22 18 4 OE1 A GLU 66 ? ? HZ3 A LYS 114 ? ? 1.53 19 4 OE1 A GLU 6 ? ? HZ3 A LYS 10 ? ? 1.56 20 4 OD2 A ASP 38 ? ? HZ2 A LYS 39 ? ? 1.60 21 4 OE1 A GLU 129 ? ? HD1 A HIS 133 ? ? 1.60 22 5 HZ1 A LYS 34 ? ? OE2 A GLU 36 ? ? 1.55 23 5 OE1 A GLU 123 ? ? HZ1 A LYS 127 ? ? 1.56 24 5 HZ1 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.57 25 5 OE1 A GLU 62 ? ? HZ3 A LYS 114 ? ? 1.57 26 5 OD2 A ASP 122 ? ? HZ3 A LYS 127 ? ? 1.59 27 5 OE1 A GLU 102 ? ? HE2 A HIS 131 ? ? 1.59 28 6 OD2 A ASP 38 ? ? HZ2 A LYS 39 ? ? 1.52 29 6 HZ1 A LYS 119 ? ? OE1 A GLU 123 ? ? 1.56 30 6 HZ1 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.56 31 6 OE1 A GLU 62 ? ? HZ3 A LYS 65 ? ? 1.56 32 7 HZ2 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.53 33 7 HZ2 A LYS 16 ? ? OE2 A GLU 83 ? ? 1.55 34 7 OD2 A ASP 38 ? ? HZ3 A LYS 39 ? ? 1.57 35 7 OD2 A ASP 44 ? ? HZ3 A LYS 75 ? ? 1.57 36 7 HZ3 A LYS 10 ? ? OD2 A ASP 68 ? ? 1.57 37 7 OE1 A GLU 123 ? ? HZ2 A LYS 127 ? ? 1.57 38 7 OE1 A GLU 106 ? ? HD1 A HIS 131 ? ? 1.58 39 8 HZ2 A LYS 16 ? ? OE1 A GLU 81 ? ? 1.53 40 8 HZ3 A LYS 119 ? ? OE2 A GLU 123 ? ? 1.54 41 8 OD2 A ASP 38 ? ? HZ3 A LYS 39 ? ? 1.54 42 8 OE2 A GLU 62 ? ? HZ3 A LYS 65 ? ? 1.56 43 8 OE2 A GLU 18 ? ? HZ3 A LYS 22 ? ? 1.56 44 8 HZ2 A LYS 65 ? ? OE2 A GLU 66 ? ? 1.56 45 8 OD2 A ASP 44 ? ? HZ2 A LYS 75 ? ? 1.57 46 8 OE1 A GLU 62 ? ? HZ1 A LYS 114 ? ? 1.60 47 9 HE2 A TYR 24 ? ? HZ A PHE 88 ? ? 1.18 48 9 HG21 A THR 15 ? ? HZ1 A LYS 80 ? ? 1.33 49 9 HZ3 A LYS 34 ? ? OE2 A GLU 36 ? ? 1.56 50 9 OD1 A ASP 122 ? ? HZ1 A LYS 127 ? ? 1.57 51 9 OE1 A GLU 62 ? ? HZ1 A LYS 114 ? ? 1.59 52 10 OD2 A ASP 44 ? ? HZ3 A LYS 75 ? ? 1.55 53 10 OE2 A GLU 106 ? ? HD1 A HIS 135 ? ? 1.56 54 10 H1 A MET 1 ? ? OE1 A GLU 6 ? ? 1.57 55 10 OE1 A GLU 62 ? ? HZ2 A LYS 65 ? ? 1.57 56 11 OE2 A GLU 18 ? ? HZ3 A LYS 22 ? ? 1.56 57 11 HZ3 A LYS 16 ? ? OE2 A GLU 81 ? ? 1.58 58 12 HZ1 A LYS 34 ? ? OE1 A GLU 36 ? ? 1.53 59 12 HZ2 A LYS 28 ? ? OE2 A GLU 36 ? ? 1.54 60 12 OD2 A ASP 38 ? ? HZ2 A LYS 39 ? ? 1.55 61 12 OE2 A GLU 102 ? ? HZ1 A LYS 128 ? ? 1.56 62 12 HZ3 A LYS 127 ? ? OE2 A GLU 129 ? ? 1.58 63 12 HZ1 A LYS 16 ? ? OE1 A GLU 81 ? ? 1.58 64 12 HZ3 A LYS 118 ? ? OD2 A ASP 122 ? ? 1.58 65 12 OD1 A ASP 77 ? ? HZ1 A LYS 80 ? ? 1.58 66 12 OE1 A GLU 32 ? ? HZ2 A LYS 104 ? ? 1.59 67 12 OD1 A ASN 25 ? ? HZ1 A LYS 28 ? ? 1.59 68 13 HD1 A TRP 33 ? ? HZ1 A LYS 104 ? ? 0.99 69 13 OD2 A ASP 44 ? ? HZ2 A LYS 75 ? ? 1.55 70 13 OD2 A ASP 38 ? ? HZ2 A LYS 39 ? ? 1.56 71 13 OE1 A GLU 62 ? ? HZ3 A LYS 114 ? ? 1.57 72 13 HZ1 A LYS 16 ? ? OE1 A GLU 81 ? ? 1.57 73 13 HZ1 A LYS 119 ? ? OE2 A GLU 123 ? ? 1.58 74 14 HZ2 A LYS 119 ? ? OE2 A GLU 123 ? ? 1.52 75 14 OE2 A GLU 62 ? ? HZ3 A LYS 65 ? ? 1.54 76 14 OD2 A ASP 38 ? ? HZ3 A LYS 39 ? ? 1.54 77 14 OD2 A ASP 44 ? ? HZ3 A LYS 75 ? ? 1.54 78 14 OE1 A GLU 62 ? ? HZ2 A LYS 114 ? ? 1.57 79 15 HZ2 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.55 80 15 OD1 A ASP 38 ? ? HZ3 A LYS 39 ? ? 1.56 81 15 OE2 A GLU 62 ? ? HZ3 A LYS 65 ? ? 1.56 82 15 HZ3 A LYS 10 ? ? OD2 A ASP 68 ? ? 1.56 83 15 O A ASN 8 ? ? HZ1 A LYS 10 ? ? 1.59 84 15 OE1 A GLU 6 ? ? HZ1 A LYS 39 ? ? 1.60 85 16 HZ2 A LYS 34 ? ? OE2 A GLU 36 ? ? 1.53 86 16 OD2 A ASP 38 ? ? HZ2 A LYS 39 ? ? 1.53 87 16 OE2 A GLU 6 ? ? HZ1 A LYS 22 ? ? 1.54 88 16 OE1 A GLU 102 ? ? HZ1 A LYS 128 ? ? 1.57 89 16 OD2 A ASP 77 ? ? HZ1 A LYS 80 ? ? 1.57 90 17 HE3 A LYS 28 ? ? HD22 A ASN 29 ? ? 1.19 91 17 OE1 A GLU 18 ? ? HZ1 A LYS 22 ? ? 1.55 92 17 OE2 A GLU 62 ? ? HZ3 A LYS 65 ? ? 1.55 93 17 OE1 A GLU 129 ? ? HE2 A HIS 133 ? ? 1.55 94 17 O A ASP 122 ? ? H A LYS 127 ? ? 1.57 95 17 HZ3 A LYS 118 ? ? OD2 A ASP 122 ? ? 1.58 96 17 OD1 A ASP 122 ? ? HZ3 A LYS 127 ? ? 1.59 97 17 OE1 A GLU 32 ? ? HZ1 A LYS 34 ? ? 1.59 98 17 OE1 A GLU 102 ? ? HZ1 A LYS 128 ? ? 1.59 99 18 HB3 A CYS 50 ? ? HG A CYS 53 ? ? 1.27 100 18 HZ1 A LYS 34 ? ? OE1 A GLU 36 ? ? 1.53 101 18 OE2 A GLU 6 ? ? HZ1 A LYS 10 ? ? 1.55 102 18 HZ2 A LYS 28 ? ? OE2 A GLU 36 ? ? 1.58 103 18 HZ2 A LYS 16 ? ? OE1 A GLU 83 ? ? 1.58 104 19 HZ3 A TRP 33 ? ? HE1 A PHE 88 ? ? 1.32 105 19 HZ3 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.55 106 19 HZ1 A LYS 16 ? ? OE2 A GLU 83 ? ? 1.56 107 19 OD2 A ASP 38 ? ? HZ1 A LYS 39 ? ? 1.58 108 19 OE1 A GLU 27 ? ? HZ2 A LYS 28 ? ? 1.59 109 19 HZ1 A LYS 119 ? ? OE1 A GLU 123 ? ? 1.59 110 19 OD2 A ASP 44 ? ? HZ3 A LYS 75 ? ? 1.59 111 20 HD1 A TRP 33 ? ? HZ3 A LYS 104 ? ? 1.28 112 20 OE2 A GLU 123 ? ? HZ2 A LYS 127 ? ? 1.55 113 20 HZ1 A LYS 80 ? ? OE1 A GLU 81 ? ? 1.57 114 20 OE1 A GLU 123 ? ? HD1 A HIS 134 ? ? 1.57 115 20 OE2 A GLU 62 ? ? HZ3 A LYS 114 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 4 ? ? -152.14 87.44 2 1 GLU A 6 ? ? 56.59 -132.85 3 1 VAL A 23 ? ? -129.06 -52.90 4 1 GLU A 81 ? ? -90.83 44.23 5 1 ARG A 91 ? ? 72.03 -67.77 6 1 SER A 92 ? ? -151.77 -89.31 7 1 PHE A 124 ? ? -138.46 -50.35 8 1 HIS A 135 ? ? 167.59 -46.80 9 2 LEU A 3 ? ? -101.33 -72.08 10 2 VAL A 23 ? ? -141.02 -56.34 11 2 GLU A 81 ? ? -97.85 42.87 12 2 SER A 92 ? ? -177.65 -85.29 13 2 PHE A 124 ? ? -143.51 -53.40 14 3 LEU A 3 ? ? -100.67 -70.53 15 3 ALA A 4 ? ? -171.81 -62.16 16 3 TYR A 24 ? ? -164.95 117.88 17 3 ASN A 29 ? ? -118.69 61.54 18 3 GLU A 36 ? ? -84.53 40.81 19 3 GLU A 81 ? ? -82.26 30.75 20 3 SER A 92 ? ? 178.14 -94.83 21 3 PHE A 124 ? ? -151.63 -48.41 22 3 HIS A 131 ? ? 49.77 -86.95 23 3 HIS A 133 ? ? -125.20 -84.77 24 4 ALA A 4 ? ? -168.65 -80.29 25 4 THR A 5 ? ? 63.33 88.95 26 4 VAL A 23 ? ? -140.34 -50.69 27 4 TYR A 24 ? ? -175.14 116.02 28 4 ASP A 38 ? ? -141.54 -55.34 29 4 GLU A 81 ? ? -100.11 43.24 30 4 SER A 92 ? ? -160.82 -79.71 31 4 LYS A 128 ? ? -51.69 96.90 32 4 HIS A 135 ? ? -76.99 43.92 33 5 SER A 2 ? ? 75.82 -31.20 34 5 TRP A 33 ? ? -69.46 93.20 35 5 ASP A 38 ? ? -163.74 -60.67 36 5 GLU A 81 ? ? -97.86 45.25 37 5 SER A 92 ? ? 175.65 -91.03 38 5 LYS A 128 ? ? -48.42 99.62 39 5 HIS A 134 ? ? -171.66 62.83 40 6 THR A 5 ? ? 67.14 87.65 41 6 VAL A 23 ? ? -132.45 -45.41 42 6 TYR A 24 ? ? -164.42 116.74 43 6 GLU A 81 ? ? -85.93 39.63 44 6 SER A 92 ? ? 177.17 -93.59 45 6 PHE A 124 ? ? -120.81 -52.49 46 6 LYS A 128 ? ? 30.77 82.66 47 6 HIS A 135 ? ? -143.26 18.23 48 7 THR A 5 ? ? 56.79 -147.21 49 7 GLU A 6 ? ? -131.75 -52.09 50 7 GLU A 81 ? ? -84.85 33.60 51 7 SER A 92 ? ? 82.50 -88.00 52 7 PHE A 124 ? ? -143.56 -47.50 53 7 LYS A 128 ? ? -54.31 100.55 54 7 HIS A 131 ? ? -65.36 93.23 55 7 HIS A 133 ? ? -82.44 37.06 56 8 LEU A 3 ? ? -101.30 -74.46 57 8 GLU A 6 ? ? 72.39 -56.57 58 8 TYR A 24 ? ? -173.03 132.41 59 8 ASN A 29 ? ? -116.42 55.63 60 8 TRP A 33 ? ? -151.95 88.49 61 8 GLU A 81 ? ? -82.75 47.35 62 8 SER A 92 ? ? -169.72 -137.63 63 8 PHE A 124 ? ? -140.09 -49.92 64 8 HIS A 132 ? ? 179.82 107.68 65 8 HIS A 134 ? ? 176.34 -30.03 66 8 HIS A 135 ? ? -158.16 -26.67 67 9 ALA A 4 ? ? -153.80 33.95 68 9 THR A 5 ? ? 74.98 96.96 69 9 VAL A 23 ? ? -134.79 -49.27 70 9 TYR A 24 ? ? -177.88 125.62 71 9 ASN A 29 ? ? -111.68 53.45 72 9 GLU A 81 ? ? -94.56 38.73 73 9 SER A 92 ? ? 170.26 -89.14 74 9 PHE A 124 ? ? -127.65 -51.74 75 9 LYS A 128 ? ? -57.77 104.05 76 9 GLU A 129 ? ? -77.75 46.41 77 9 HIS A 131 ? ? -146.45 -157.25 78 9 HIS A 132 ? ? -80.00 32.93 79 9 HIS A 133 ? ? -171.40 136.02 80 10 SER A 2 ? ? -177.30 -82.76 81 10 VAL A 23 ? ? -142.68 -49.03 82 10 TYR A 24 ? ? -164.08 116.68 83 10 ASP A 38 ? ? -149.57 -58.79 84 10 GLU A 81 ? ? -83.62 36.66 85 10 SER A 92 ? ? -164.60 -101.19 86 10 LYS A 128 ? ? 37.73 33.57 87 11 SER A 2 ? ? 42.64 -113.65 88 11 TYR A 24 ? ? -169.86 116.62 89 11 GLU A 36 ? ? -112.10 -167.18 90 11 ASP A 38 ? ? -158.92 -50.78 91 11 GLN A 70 ? ? -121.65 -53.42 92 11 GLU A 81 ? ? -89.47 42.73 93 11 SER A 92 ? ? -156.25 -88.44 94 11 PHE A 124 ? ? -131.74 -48.19 95 11 GLU A 129 ? ? 73.52 150.27 96 12 SER A 2 ? ? -145.60 -44.75 97 12 ALA A 4 ? ? -162.94 -66.67 98 12 THR A 5 ? ? -133.47 -37.44 99 12 GLU A 6 ? ? 55.92 -90.72 100 12 ASN A 8 ? ? -164.29 102.43 101 12 VAL A 23 ? ? -133.66 -45.09 102 12 TYR A 24 ? ? -161.32 115.38 103 12 ASP A 38 ? ? -124.79 -52.57 104 12 GLU A 81 ? ? -93.91 46.21 105 12 SER A 92 ? ? -179.66 -85.45 106 12 PHE A 124 ? ? -138.11 -42.57 107 12 HIS A 131 ? ? 62.93 -93.93 108 12 HIS A 132 ? ? 160.39 21.92 109 12 HIS A 135 ? ? 179.05 -44.55 110 13 SER A 2 ? ? 65.26 -80.12 111 13 LEU A 3 ? ? -100.59 -73.79 112 13 THR A 5 ? ? -121.65 -76.29 113 13 ASN A 8 ? ? -175.34 112.32 114 13 TYR A 24 ? ? -163.72 115.74 115 13 SER A 92 ? ? -179.23 -93.95 116 13 PHE A 124 ? ? -134.38 -52.35 117 13 GLU A 129 ? ? -44.38 -76.69 118 13 HIS A 134 ? ? -159.11 74.74 119 13 HIS A 135 ? ? -177.35 138.86 120 14 VAL A 23 ? ? -136.34 -49.99 121 14 GLU A 81 ? ? -81.50 39.48 122 14 SER A 92 ? ? -158.19 -84.30 123 14 HIS A 132 ? ? 56.04 -79.54 124 14 HIS A 133 ? ? -109.57 -100.70 125 15 SER A 2 ? ? 59.04 -91.39 126 15 LEU A 3 ? ? -100.41 -72.93 127 15 ALA A 4 ? ? -107.64 -81.12 128 15 GLU A 6 ? ? -171.85 -178.66 129 15 TYR A 24 ? ? -160.82 115.05 130 15 ASP A 38 ? ? -165.41 -61.38 131 15 GLU A 81 ? ? -91.18 40.99 132 15 SER A 92 ? ? 179.69 -80.61 133 15 PHE A 124 ? ? -143.17 -47.51 134 15 GLU A 129 ? ? 76.89 144.75 135 15 HIS A 131 ? ? 70.97 89.09 136 16 VAL A 23 ? ? -134.52 -54.54 137 16 GLU A 81 ? ? -98.20 39.71 138 16 SER A 92 ? ? 175.39 -99.65 139 16 LYS A 127 ? ? -89.10 45.89 140 16 HIS A 135 ? ? -151.57 -52.46 141 17 VAL A 23 ? ? -135.85 -55.68 142 17 ASN A 29 ? ? -119.12 67.97 143 17 GLU A 36 ? ? -90.32 31.43 144 17 GLU A 81 ? ? -78.86 39.63 145 17 SER A 92 ? ? -167.48 -88.15 146 17 GLU A 129 ? ? 80.42 57.65 147 17 HIS A 131 ? ? -48.76 104.40 148 18 SER A 2 ? ? -164.56 90.79 149 18 ASN A 8 ? ? 64.02 96.82 150 18 VAL A 23 ? ? -141.46 -47.76 151 18 TYR A 24 ? ? -167.41 119.61 152 18 ASP A 38 ? ? -149.27 -42.47 153 18 GLU A 81 ? ? -88.73 41.97 154 18 SER A 92 ? ? -155.72 -90.30 155 18 LYS A 127 ? ? -101.05 -156.72 156 19 GLU A 6 ? ? -79.90 -85.44 157 19 TYR A 24 ? ? -166.99 118.83 158 19 ASN A 29 ? ? -119.79 65.63 159 19 GLU A 81 ? ? -89.53 34.89 160 19 ARG A 91 ? ? -69.11 -81.82 161 19 SER A 92 ? ? -158.99 -81.26 162 19 LYS A 128 ? ? -64.97 84.12 163 19 HIS A 132 ? ? -18.66 112.89 164 19 HIS A 135 ? ? -140.58 -49.34 165 20 ALA A 4 ? ? -88.46 34.40 166 20 THR A 5 ? ? 48.43 -98.18 167 20 GLU A 6 ? ? -176.65 -72.51 168 20 VAL A 23 ? ? -132.96 -51.99 169 20 TYR A 24 ? ? -179.19 131.00 170 20 ASN A 29 ? ? -116.89 62.55 171 20 ASP A 38 ? ? -147.92 -64.64 172 20 GLU A 81 ? ? -89.06 42.89 173 20 SER A 92 ? ? -150.92 -96.96 174 20 LYS A 128 ? ? -49.44 96.61 175 20 HIS A 131 ? ? 59.37 74.37 176 20 HIS A 132 ? ? -145.26 -56.65 177 20 HIS A 133 ? ? -172.12 130.23 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'New York SGX Research Center for Structural Genomics' 1 NYSGXRC 'PSI, Protein Structure Initiative' 'New York Structural Genomics Research Consortium' 2 NYSGRC PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L5L _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L5L _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] thioredoxin, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] thioredoxin, 20 mM sodium phosphate, 50 mM sodium chloride, 1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id thioredoxin-1 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 DTT-4 1 ? mM ? 1 thioredoxin-5 1 ? mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate-6' 20 ? mM ? 2 'sodium chloride-7' 50 ? mM ? 2 DTT-8 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C HSQC' 1 4 2 'aromatic 13C HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L5L _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 74 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2480 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 571 _pdbx_nmr_constraints.NOE_long_range_total_count 731 _pdbx_nmr_constraints.NOE_medium_range_total_count 548 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 551 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 95 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 94 # _pdbx_nmr_refine.entry_id 2L5L _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger A. T. et.al.' refinement CNS ? 1 CCPN 'data analysis' CCPN_Analysis ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 600 Bruker DRX 2 'Bruker DRX' # _atom_sites.entry_id 2L5L _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_