data_2L5O # _entry.id 2L5O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L5O pdb_00002l5o 10.2210/pdb2l5o/pdb RCSB RCSB101988 ? ? WWPDB D_1000101988 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-12-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2013-05-08 4 'Structure model' 1 3 2018-11-14 5 'Structure model' 1 4 2021-02-10 6 'Structure model' 1 5 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Structure summary' 5 5 'Structure model' 'Data collection' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' audit_author 2 5 'Structure model' audit_author 3 5 'Structure model' citation_author 4 5 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' struct_ref_seq_dif 6 6 'Structure model' chem_comp_atom 7 6 'Structure model' chem_comp_bond 8 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_audit_author.identifier_ORCID' 2 5 'Structure model' '_audit_author.identifier_ORCID' 3 5 'Structure model' '_citation_author.identifier_ORCID' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_ref_seq_dif.details' 6 6 'Structure model' '_database_2.pdbx_DOI' 7 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L5O _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-03 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified NYSGXRC-11210e TargetDB . unspecified NYSGRC-011326 TargetTrack . # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Harris, R.' 1 ? 'Foti, R.' 2 ? 'Seidel, R.D.' 3 ? 'Bonanno, J.B.' 4 ? 'Freeman, J.' 5 ? 'Bain, K.T.' 6 ? 'Sauder, J.M.' 7 0000-0002-0254-4955 'Burley, S.K.' 8 0000-0002-2487-9713 'Girvin, M.E.' 9 ? 'Almo, S.C.' 10 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 11 ? 'New York Structural Genomics Research Consortium (NYSGRC)' 12 ? # _citation.id primary _citation.title 'Solution Structure of a Putative Thioredoxin from Neisseria meningitidis' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Harris, R.' 1 ? primary 'Foti, R.' 2 ? primary 'Seidel, R.D.' 3 ? primary 'Bonanno, J.B.' 4 ? primary 'Freeman, J.' 5 ? primary 'Bain, K.T.' 6 ? primary 'Sauder, J.M.' 7 ? primary 'Burley, S.K.' 8 0000-0002-2487-9713 primary 'Girvin, M.E.' 9 ? primary 'Almo, S.C.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative thioredoxin' _entity.formula_weight 17046.285 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQY VKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQY VKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDAEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier 'NYSGXRC-11210e, NYSGRC-011326' # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 LEU n 1 4 ASP n 1 5 SER n 1 6 LYS n 1 7 THR n 1 8 ALA n 1 9 PRO n 1 10 ALA n 1 11 PHE n 1 12 SER n 1 13 LEU n 1 14 PRO n 1 15 ASP n 1 16 LEU n 1 17 HIS n 1 18 GLY n 1 19 LYS n 1 20 THR n 1 21 VAL n 1 22 SER n 1 23 ASN n 1 24 ALA n 1 25 ASP n 1 26 LEU n 1 27 GLN n 1 28 GLY n 1 29 LYS n 1 30 VAL n 1 31 THR n 1 32 LEU n 1 33 ILE n 1 34 ASN n 1 35 PHE n 1 36 TRP n 1 37 PHE n 1 38 PRO n 1 39 SER n 1 40 CYS n 1 41 PRO n 1 42 GLY n 1 43 CYS n 1 44 VAL n 1 45 SER n 1 46 GLU n 1 47 MET n 1 48 PRO n 1 49 LYS n 1 50 ILE n 1 51 ILE n 1 52 LYS n 1 53 THR n 1 54 ALA n 1 55 ASN n 1 56 ASP n 1 57 TYR n 1 58 LYS n 1 59 ASN n 1 60 LYS n 1 61 ASN n 1 62 PHE n 1 63 GLN n 1 64 VAL n 1 65 LEU n 1 66 ALA n 1 67 VAL n 1 68 ALA n 1 69 GLN n 1 70 PRO n 1 71 ILE n 1 72 ASP n 1 73 PRO n 1 74 ILE n 1 75 GLU n 1 76 SER n 1 77 VAL n 1 78 ARG n 1 79 GLN n 1 80 TYR n 1 81 VAL n 1 82 LYS n 1 83 ASP n 1 84 TYR n 1 85 GLY n 1 86 LEU n 1 87 PRO n 1 88 PHE n 1 89 THR n 1 90 VAL n 1 91 MET n 1 92 TYR n 1 93 ASP n 1 94 ALA n 1 95 ASP n 1 96 LYS n 1 97 ALA n 1 98 VAL n 1 99 GLY n 1 100 GLN n 1 101 ALA n 1 102 PHE n 1 103 GLY n 1 104 THR n 1 105 GLN n 1 106 VAL n 1 107 TYR n 1 108 PRO n 1 109 THR n 1 110 SER n 1 111 VAL n 1 112 LEU n 1 113 ILE n 1 114 GLY n 1 115 LYS n 1 116 LYS n 1 117 GLY n 1 118 GLU n 1 119 ILE n 1 120 LEU n 1 121 LYS n 1 122 THR n 1 123 TYR n 1 124 VAL n 1 125 GLY n 1 126 GLU n 1 127 PRO n 1 128 ASP n 1 129 PHE n 1 130 GLY n 1 131 LYS n 1 132 LEU n 1 133 TYR n 1 134 GLN n 1 135 GLU n 1 136 ILE n 1 137 ASP n 1 138 THR n 1 139 ALA n 1 140 TRP n 1 141 ARG n 1 142 ASN n 1 143 SER n 1 144 ASP n 1 145 ALA n 1 146 GLU n 1 147 GLY n 1 148 HIS n 1 149 HIS n 1 150 HIS n 1 151 HIS n 1 152 HIS n 1 153 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene NMB1958 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Neisseria meningitidis serogroup B' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 491 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'modified pET26' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 LEU 3 0 ? ? ? A . n A 1 4 ASP 4 1 1 ASP ASP A . n A 1 5 SER 5 2 2 SER SER A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 THR 7 4 4 THR THR A . n A 1 8 ALA 8 5 5 ALA ALA A . n A 1 9 PRO 9 6 6 PRO PRO A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 PHE 11 8 8 PHE PHE A . n A 1 12 SER 12 9 9 SER SER A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 PRO 14 11 11 PRO PRO A . n A 1 15 ASP 15 12 12 ASP ASP A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 HIS 17 14 14 HIS HIS A . n A 1 18 GLY 18 15 15 GLY GLY A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 THR 20 17 17 THR THR A . n A 1 21 VAL 21 18 18 VAL VAL A . n A 1 22 SER 22 19 19 SER SER A . n A 1 23 ASN 23 20 20 ASN ASN A . n A 1 24 ALA 24 21 21 ALA ALA A . n A 1 25 ASP 25 22 22 ASP ASP A . n A 1 26 LEU 26 23 23 LEU LEU A . n A 1 27 GLN 27 24 24 GLN GLN A . n A 1 28 GLY 28 25 25 GLY GLY A . n A 1 29 LYS 29 26 26 LYS LYS A . n A 1 30 VAL 30 27 27 VAL VAL A . n A 1 31 THR 31 28 28 THR THR A . n A 1 32 LEU 32 29 29 LEU LEU A . n A 1 33 ILE 33 30 30 ILE ILE A . n A 1 34 ASN 34 31 31 ASN ASN A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 TRP 36 33 33 TRP TRP A . n A 1 37 PHE 37 34 34 PHE PHE A . n A 1 38 PRO 38 35 35 PRO PRO A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 CYS 40 37 37 CYS CYS A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 GLY 42 39 39 GLY GLY A . n A 1 43 CYS 43 40 40 CYS CYS A . n A 1 44 VAL 44 41 41 VAL VAL A . n A 1 45 SER 45 42 42 SER SER A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 MET 47 44 44 MET MET A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 LYS 49 46 46 LYS LYS A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 LYS 52 49 49 LYS LYS A . n A 1 53 THR 53 50 50 THR THR A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 ASN 55 52 52 ASN ASN A . n A 1 56 ASP 56 53 53 ASP ASP A . n A 1 57 TYR 57 54 54 TYR TYR A . n A 1 58 LYS 58 55 55 LYS LYS A . n A 1 59 ASN 59 56 56 ASN ASN A . n A 1 60 LYS 60 57 57 LYS LYS A . n A 1 61 ASN 61 58 58 ASN ASN A . n A 1 62 PHE 62 59 59 PHE PHE A . n A 1 63 GLN 63 60 60 GLN GLN A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 LEU 65 62 62 LEU LEU A . n A 1 66 ALA 66 63 63 ALA ALA A . n A 1 67 VAL 67 64 64 VAL VAL A . n A 1 68 ALA 68 65 65 ALA ALA A . n A 1 69 GLN 69 66 66 GLN GLN A . n A 1 70 PRO 70 67 67 PRO PRO A . n A 1 71 ILE 71 68 68 ILE ILE A . n A 1 72 ASP 72 69 69 ASP ASP A . n A 1 73 PRO 73 70 70 PRO PRO A . n A 1 74 ILE 74 71 71 ILE ILE A . n A 1 75 GLU 75 72 72 GLU GLU A . n A 1 76 SER 76 73 73 SER SER A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 ARG 78 75 75 ARG ARG A . n A 1 79 GLN 79 76 76 GLN GLN A . n A 1 80 TYR 80 77 77 TYR TYR A . n A 1 81 VAL 81 78 78 VAL VAL A . n A 1 82 LYS 82 79 79 LYS LYS A . n A 1 83 ASP 83 80 80 ASP ASP A . n A 1 84 TYR 84 81 81 TYR TYR A . n A 1 85 GLY 85 82 82 GLY GLY A . n A 1 86 LEU 86 83 83 LEU LEU A . n A 1 87 PRO 87 84 84 PRO PRO A . n A 1 88 PHE 88 85 85 PHE PHE A . n A 1 89 THR 89 86 86 THR THR A . n A 1 90 VAL 90 87 87 VAL VAL A . n A 1 91 MET 91 88 88 MET MET A . n A 1 92 TYR 92 89 89 TYR TYR A . n A 1 93 ASP 93 90 90 ASP ASP A . n A 1 94 ALA 94 91 91 ALA ALA A . n A 1 95 ASP 95 92 92 ASP ASP A . n A 1 96 LYS 96 93 93 LYS LYS A . n A 1 97 ALA 97 94 94 ALA ALA A . n A 1 98 VAL 98 95 95 VAL VAL A . n A 1 99 GLY 99 96 96 GLY GLY A . n A 1 100 GLN 100 97 97 GLN GLN A . n A 1 101 ALA 101 98 98 ALA ALA A . n A 1 102 PHE 102 99 99 PHE PHE A . n A 1 103 GLY 103 100 100 GLY GLY A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 GLN 105 102 102 GLN GLN A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 TYR 107 104 104 TYR TYR A . n A 1 108 PRO 108 105 105 PRO PRO A . n A 1 109 THR 109 106 106 THR THR A . n A 1 110 SER 110 107 107 SER SER A . n A 1 111 VAL 111 108 108 VAL VAL A . n A 1 112 LEU 112 109 109 LEU LEU A . n A 1 113 ILE 113 110 110 ILE ILE A . n A 1 114 GLY 114 111 111 GLY GLY A . n A 1 115 LYS 115 112 112 LYS LYS A . n A 1 116 LYS 116 113 113 LYS LYS A . n A 1 117 GLY 117 114 114 GLY GLY A . n A 1 118 GLU 118 115 115 GLU GLU A . n A 1 119 ILE 119 116 116 ILE ILE A . n A 1 120 LEU 120 117 117 LEU LEU A . n A 1 121 LYS 121 118 118 LYS LYS A . n A 1 122 THR 122 119 119 THR THR A . n A 1 123 TYR 123 120 120 TYR TYR A . n A 1 124 VAL 124 121 121 VAL VAL A . n A 1 125 GLY 125 122 122 GLY GLY A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 PRO 127 124 124 PRO PRO A . n A 1 128 ASP 128 125 125 ASP ASP A . n A 1 129 PHE 129 126 126 PHE PHE A . n A 1 130 GLY 130 127 127 GLY GLY A . n A 1 131 LYS 131 128 128 LYS LYS A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 TYR 133 130 130 TYR TYR A . n A 1 134 GLN 134 131 131 GLN GLN A . n A 1 135 GLU 135 132 132 GLU GLU A . n A 1 136 ILE 136 133 133 ILE ILE A . n A 1 137 ASP 137 134 134 ASP ASP A . n A 1 138 THR 138 135 135 THR THR A . n A 1 139 ALA 139 136 136 ALA ALA A . n A 1 140 TRP 140 137 137 TRP TRP A . n A 1 141 ARG 141 138 138 ARG ARG A . n A 1 142 ASN 142 139 139 ASN ASN A . n A 1 143 SER 143 140 140 SER SER A . n A 1 144 ASP 144 141 141 ASP ASP A . n A 1 145 ALA 145 142 142 ALA ALA A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 GLY 147 144 144 GLY GLY A . n A 1 148 HIS 148 145 145 HIS HIS A . n A 1 149 HIS 149 146 146 HIS HIS A . n A 1 150 HIS 150 147 147 HIS HIS A . n A 1 151 HIS 151 148 148 HIS HIS A . n A 1 152 HIS 152 149 149 HIS HIS A . n A 1 153 HIS 153 150 150 HIS HIS A . n # _cell.entry_id 2L5O _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2L5O _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L5O _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L5O _struct.title 'Solution Structure of a Putative Thioredoxin from Neisseria meningitidis' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L5O _struct_keywords.pdbx_keywords OXIDOREDUCTASE _struct_keywords.text ;STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, NYSGRC, PSI-Biology, TRANSPORT PROTEIN OXIDOREDUCTASE, OXIDOREDUCTASE, New York Structural Genomics Research Consortium ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9JXN4_NEIMB _struct_ref.pdbx_db_accession Q9JXN4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVKD YGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAWRNSDA ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L5O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9JXN4 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 142 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L5O MET A 1 ? UNP Q9JXN4 ? ? 'expression tag' -2 1 1 2L5O SER A 2 ? UNP Q9JXN4 ? ? 'expression tag' -1 2 1 2L5O LEU A 3 ? UNP Q9JXN4 ? ? 'expression tag' 0 3 1 2L5O GLU A 146 ? UNP Q9JXN4 ? ? 'expression tag' 143 4 1 2L5O GLY A 147 ? UNP Q9JXN4 ? ? 'expression tag' 144 5 1 2L5O HIS A 148 ? UNP Q9JXN4 ? ? 'expression tag' 145 6 1 2L5O HIS A 149 ? UNP Q9JXN4 ? ? 'expression tag' 146 7 1 2L5O HIS A 150 ? UNP Q9JXN4 ? ? 'expression tag' 147 8 1 2L5O HIS A 151 ? UNP Q9JXN4 ? ? 'expression tag' 148 9 1 2L5O HIS A 152 ? UNP Q9JXN4 ? ? 'expression tag' 149 10 1 2L5O HIS A 153 ? UNP Q9JXN4 ? ? 'expression tag' 150 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 23 ? GLN A 27 ? ASN A 20 GLN A 24 1 ? 5 HELX_P HELX_P2 2 GLY A 42 ? TYR A 57 ? GLY A 39 TYR A 54 1 ? 16 HELX_P HELX_P3 3 PRO A 73 ? TYR A 84 ? PRO A 70 TYR A 81 1 ? 12 HELX_P HELX_P4 4 LYS A 96 ? GLY A 103 ? LYS A 93 GLY A 100 1 ? 8 HELX_P HELX_P5 5 ASP A 128 ? ASN A 142 ? ASP A 125 ASN A 139 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 1 -0.09 2 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 2 0.43 3 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 3 0.09 4 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 4 0.38 5 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 5 0.20 6 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 6 0.11 7 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 7 -0.24 8 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 8 0.69 9 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 9 -0.22 10 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 10 0.12 11 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 11 0.04 12 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 12 -0.49 13 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 13 0.45 14 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 14 0.36 15 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 15 0.48 16 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 16 -0.46 17 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 17 0.18 18 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 18 0.25 19 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 19 -0.16 20 TYR 107 A . ? TYR 104 A PRO 108 A ? PRO 105 A 20 0.41 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 12 ? PRO A 14 ? SER A 9 PRO A 11 A 2 THR A 20 ? SER A 22 ? THR A 17 SER A 19 B 1 THR A 89 ? TYR A 92 ? THR A 86 TYR A 89 B 2 PHE A 62 ? ALA A 68 ? PHE A 59 ALA A 65 B 3 VAL A 30 ? TRP A 36 ? VAL A 27 TRP A 33 B 4 THR A 109 ? ILE A 113 ? THR A 106 ILE A 110 B 5 LYS A 121 ? VAL A 124 ? LYS A 118 VAL A 121 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 13 ? N LEU A 10 O VAL A 21 ? O VAL A 18 B 1 2 O MET A 91 ? O MET A 88 N ALA A 68 ? N ALA A 65 B 2 3 O VAL A 67 ? O VAL A 64 N ASN A 34 ? N ASN A 31 B 3 4 N THR A 31 ? N THR A 28 O ILE A 113 ? O ILE A 110 B 4 5 N SER A 110 ? N SER A 107 O TYR A 123 ? O TYR A 120 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 12 ? ? HZ2 A LYS 16 ? ? 1.54 2 1 OE2 A GLU 72 ? ? HZ2 A LYS 79 ? ? 1.59 3 2 HD2 A LYS 57 ? ? HH2 A TRP 137 ? ? 1.18 4 2 HB2 A LEU 29 ? ? HZ A PHE 59 ? ? 1.27 5 2 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.33 6 2 HZ1 A LYS 16 ? ? OD2 A ASP 22 ? ? 1.56 7 2 OE2 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.57 8 3 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.09 9 3 HZ2 A LYS 49 ? ? OD2 A ASP 53 ? ? 1.56 10 3 HZ2 A LYS 57 ? ? OD2 A ASP 134 ? ? 1.58 11 3 OE2 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.59 12 4 HZ2 A LYS 46 ? ? OE2 A GLU 123 ? ? 1.52 13 4 OD2 A ASP 134 ? ? HH12 A ARG 138 ? ? 1.54 14 4 HZ2 A LYS 16 ? ? OD1 A ASP 22 ? ? 1.56 15 4 OD1 A ASP 53 ? ? HZ3 A LYS 57 ? ? 1.58 16 5 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.11 17 6 HA A VAL 78 ? ? HD22 A LEU 83 ? ? 1.24 18 6 HB A ILE 30 ? ? HG12 A VAL 108 ? ? 1.33 19 6 HZ1 A LYS 16 ? ? OD2 A ASP 22 ? ? 1.55 20 6 OE2 A GLU 43 ? ? HZ2 A LYS 46 ? ? 1.55 21 6 HZ3 A LYS 79 ? ? OD1 A ASP 80 ? ? 1.57 22 6 OD1 A ASP 22 ? ? HZ2 A LYS 26 ? ? 1.60 23 7 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.17 24 7 HZ3 A LYS 16 ? ? OD2 A ASP 22 ? ? 1.56 25 8 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.25 26 8 HZ3 A LYS 46 ? ? OE2 A GLU 123 ? ? 1.56 27 8 OE2 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.57 28 9 OD2 A ASP 141 ? ? HE2 A HIS 145 ? ? 1.59 29 10 OD2 A ASP 134 ? ? HH21 A ARG 138 ? ? 1.55 30 10 HZ3 A LYS 16 ? ? OD1 A ASP 22 ? ? 1.57 31 10 OE2 A GLU 132 ? ? HE2 A HIS 145 ? ? 1.58 32 11 HZ1 A LYS 16 ? ? HG13 A VAL 18 ? ? 1.32 33 11 HZ3 A LYS 16 ? ? OD2 A ASP 22 ? ? 1.57 34 12 HD3 A PRO 67 ? ? HA A ALA 91 ? ? 1.27 35 12 OD2 A ASP 141 ? ? HD1 A HIS 146 ? ? 1.60 36 13 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.28 37 13 HZ1 A LYS 112 ? ? OD1 A ASP 141 ? ? 1.54 38 13 O A LYS 3 ? ? HG1 A THR 4 ? ? 1.55 39 13 OD2 A ASP 53 ? ? HZ2 A LYS 57 ? ? 1.55 40 13 O A CYS 37 ? ? HG A CYS 40 ? ? 1.58 41 14 HA A TYR 54 ? ? HE2 A LYS 57 ? ? 1.27 42 14 HZ1 A LYS 46 ? ? OE2 A GLU 123 ? ? 1.59 43 15 HG12 A VAL 61 ? ? HB3 A PHE 85 ? ? 1.24 44 15 HZ2 A LYS 46 ? ? OE1 A GLU 123 ? ? 1.58 45 16 OE1 A GLU 43 ? ? HZ2 A LYS 46 ? ? 1.59 46 17 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.18 47 17 HA A VAL 78 ? ? HD21 A LEU 83 ? ? 1.26 48 17 OE1 A GLU 143 ? ? HD1 A HIS 149 ? ? 1.56 49 17 OE2 A GLU 43 ? ? HZ1 A LYS 46 ? ? 1.57 50 18 OE1 A GLU 43 ? ? HZ3 A LYS 46 ? ? 1.56 51 18 HZ2 A LYS 118 ? ? OE1 A GLU 132 ? ? 1.58 52 18 HZ1 A LYS 113 ? ? OE2 A GLU 115 ? ? 1.60 53 19 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.29 54 20 HB3 A TYR 54 ? ? HB3 A PHE 59 ? ? 1.29 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 5 ? ? 46.05 72.53 2 1 ASN A 58 ? ? 162.79 14.93 3 1 PRO A 67 ? ? -67.33 80.77 4 1 THR A 101 ? ? -99.88 -66.64 5 1 GLN A 102 ? ? 72.53 -38.54 6 1 ILE A 116 ? ? 58.34 96.92 7 1 LEU A 117 ? ? -93.68 -76.03 8 1 ASP A 125 ? ? -48.75 107.66 9 1 ASN A 139 ? ? -64.19 93.28 10 1 ALA A 142 ? ? 70.02 52.17 11 1 GLU A 143 ? ? 62.94 101.83 12 2 SER A 2 ? ? 62.29 100.92 13 2 THR A 4 ? ? -148.86 35.86 14 2 ALA A 5 ? ? 66.13 108.34 15 2 LYS A 57 ? ? -100.87 -69.71 16 2 ASN A 58 ? ? 164.23 29.59 17 2 PRO A 70 ? ? -49.56 155.76 18 2 LYS A 93 ? ? 82.93 17.94 19 2 LYS A 112 ? ? -166.80 23.73 20 2 ILE A 116 ? ? 64.02 89.63 21 2 ASN A 139 ? ? -73.10 35.38 22 2 SER A 140 ? ? -150.09 13.06 23 3 SER A 2 ? ? -65.73 -72.74 24 3 LYS A 3 ? ? 55.21 -125.02 25 3 ALA A 5 ? ? 72.94 124.51 26 3 GLN A 24 ? ? -71.49 21.69 27 3 LYS A 57 ? ? -95.33 -62.81 28 3 ASN A 58 ? ? 169.66 7.31 29 3 PRO A 67 ? ? -69.30 66.49 30 3 LYS A 113 ? ? 71.92 -16.76 31 3 ASP A 125 ? ? -53.40 93.07 32 3 ASP A 141 ? ? 178.39 -164.60 33 3 HIS A 147 ? ? -60.17 94.56 34 3 HIS A 148 ? ? -101.40 76.55 35 3 HIS A 149 ? ? 176.25 166.16 36 4 LYS A 3 ? ? -102.13 -166.80 37 4 ALA A 5 ? ? 75.28 101.55 38 4 PRO A 35 ? ? -62.74 0.55 39 4 ILE A 68 ? ? -124.75 -60.81 40 4 PRO A 70 ? ? -69.33 -179.96 41 4 LYS A 93 ? ? 68.61 -2.31 42 4 GLU A 115 ? ? 69.17 -30.55 43 4 SER A 140 ? ? 169.75 121.94 44 4 ALA A 142 ? ? -162.62 108.49 45 4 HIS A 145 ? ? -66.17 86.95 46 4 HIS A 147 ? ? 62.62 -86.28 47 4 HIS A 148 ? ? 61.08 -84.64 48 5 SER A 2 ? ? 62.87 -168.07 49 5 LYS A 3 ? ? 64.76 98.95 50 5 ALA A 5 ? ? 77.02 151.14 51 5 ALA A 7 ? ? 56.62 84.93 52 5 LYS A 57 ? ? -128.25 -59.09 53 5 ASN A 58 ? ? 176.99 -14.64 54 5 PRO A 67 ? ? -64.12 79.27 55 5 LYS A 93 ? ? 47.41 25.20 56 5 LYS A 112 ? ? -140.54 -8.06 57 5 GLU A 143 ? ? 56.22 -98.03 58 6 ALA A 5 ? ? 63.74 163.42 59 6 ALA A 7 ? ? -50.94 104.67 60 6 SER A 9 ? ? -150.20 88.89 61 6 GLN A 24 ? ? -68.21 98.50 62 6 ASN A 56 ? ? -89.95 33.56 63 6 LYS A 57 ? ? -126.08 -68.35 64 6 ASN A 58 ? ? 177.03 13.72 65 6 PRO A 67 ? ? -75.91 45.07 66 6 PRO A 70 ? ? -58.20 174.02 67 6 ILE A 116 ? ? 75.93 85.24 68 6 ASP A 125 ? ? -57.14 105.16 69 6 ASP A 141 ? ? -81.35 -96.16 70 6 ALA A 142 ? ? 70.95 -59.25 71 6 GLU A 143 ? ? -179.16 -41.05 72 6 HIS A 145 ? ? -151.91 10.58 73 6 HIS A 147 ? ? -153.34 37.91 74 7 ALA A 5 ? ? 59.74 100.87 75 7 ASP A 12 ? ? -69.58 -179.29 76 7 LYS A 57 ? ? -61.26 -71.88 77 7 ASN A 58 ? ? 169.35 31.29 78 7 PRO A 67 ? ? -61.87 89.88 79 7 ILE A 68 ? ? -130.82 -66.18 80 7 LEU A 83 ? ? 48.71 87.12 81 7 PRO A 84 ? ? -79.27 44.52 82 7 GLU A 115 ? ? 52.72 -9.10 83 7 ILE A 116 ? ? 68.17 115.43 84 7 ASP A 141 ? ? -83.75 36.56 85 7 HIS A 149 ? ? -178.27 131.91 86 8 LYS A 3 ? ? -43.64 109.73 87 8 THR A 4 ? ? 151.49 -25.17 88 8 ALA A 5 ? ? 165.20 -159.72 89 8 ALA A 7 ? ? -52.29 104.75 90 8 SER A 9 ? ? -150.35 89.60 91 8 ASN A 56 ? ? -84.76 45.84 92 8 LYS A 57 ? ? -166.07 -58.48 93 8 ASN A 58 ? ? 176.46 38.06 94 8 PRO A 67 ? ? -69.62 97.35 95 8 ILE A 68 ? ? -141.19 -65.05 96 8 SER A 140 ? ? -71.49 -76.02 97 8 ASP A 141 ? ? -112.21 53.63 98 9 SER A 2 ? ? 53.17 72.71 99 9 LYS A 3 ? ? 67.27 -168.84 100 9 ALA A 5 ? ? 68.13 150.06 101 9 ASN A 56 ? ? -80.34 37.54 102 9 LYS A 57 ? ? -162.57 65.84 103 9 LYS A 112 ? ? -150.97 13.27 104 9 GLU A 123 ? ? 65.48 116.21 105 9 ASP A 141 ? ? 73.64 -26.41 106 9 GLU A 143 ? ? -155.54 -57.15 107 9 HIS A 145 ? ? -158.20 17.02 108 9 HIS A 146 ? ? 63.33 103.76 109 9 HIS A 147 ? ? 71.67 -7.46 110 10 LYS A 3 ? ? 68.62 139.56 111 10 ALA A 7 ? ? 48.63 88.39 112 10 LYS A 57 ? ? -105.23 -66.68 113 10 ASN A 58 ? ? 174.25 21.71 114 10 PRO A 67 ? ? -69.00 -135.94 115 10 ILE A 68 ? ? 77.14 -57.65 116 10 PRO A 84 ? ? -92.73 32.76 117 10 LYS A 93 ? ? 72.39 -10.93 118 10 LYS A 113 ? ? 77.45 -52.12 119 10 LEU A 117 ? ? -94.39 -68.24 120 10 HIS A 149 ? ? 69.02 155.02 121 11 SER A 2 ? ? 53.42 88.64 122 11 LYS A 3 ? ? 75.14 164.94 123 11 ALA A 5 ? ? 69.59 120.09 124 11 ASN A 58 ? ? 171.60 -11.93 125 11 PRO A 67 ? ? -69.33 -146.84 126 11 ILE A 68 ? ? 77.54 -61.10 127 11 LYS A 93 ? ? 64.54 -5.20 128 11 GLU A 123 ? ? 66.13 92.92 129 11 ASP A 125 ? ? -65.75 96.05 130 11 HIS A 147 ? ? -172.50 107.76 131 12 SER A 2 ? ? 57.47 91.87 132 12 LYS A 3 ? ? 76.14 144.20 133 12 ALA A 5 ? ? 69.27 150.40 134 12 LYS A 57 ? ? -166.94 -75.31 135 12 ASN A 58 ? ? 173.62 7.96 136 12 PRO A 67 ? ? -59.36 -92.47 137 12 ILE A 68 ? ? 65.66 -70.34 138 12 PRO A 84 ? ? -85.18 37.82 139 12 ASP A 90 ? ? -56.52 -135.21 140 12 ALA A 91 ? ? -28.66 -6.80 141 12 ASP A 92 ? ? -71.73 38.73 142 12 LYS A 93 ? ? -58.47 -3.72 143 12 LYS A 112 ? ? -92.52 43.21 144 12 LYS A 113 ? ? -140.32 -5.77 145 12 ASN A 139 ? ? -56.66 108.28 146 12 ALA A 142 ? ? -108.84 -62.42 147 12 HIS A 146 ? ? -69.86 94.60 148 12 HIS A 149 ? ? -174.26 -59.21 149 13 THR A 4 ? ? 53.75 -160.79 150 13 LYS A 57 ? ? -125.98 -63.27 151 13 ASN A 58 ? ? 172.33 -13.29 152 13 PRO A 70 ? ? -42.10 155.27 153 13 LEU A 83 ? ? 52.25 84.72 154 13 LYS A 112 ? ? -76.69 44.97 155 13 LYS A 113 ? ? 177.31 -29.63 156 13 GLU A 115 ? ? 55.68 2.79 157 13 ILE A 116 ? ? 49.54 77.27 158 13 LEU A 117 ? ? -77.15 -73.62 159 13 ASP A 141 ? ? -67.92 98.92 160 13 ALA A 142 ? ? -163.35 -53.16 161 13 HIS A 145 ? ? 50.71 81.79 162 13 HIS A 147 ? ? -158.18 77.78 163 13 HIS A 148 ? ? -168.67 -59.45 164 13 HIS A 149 ? ? -100.65 66.52 165 14 ALA A 5 ? ? 60.75 107.45 166 14 LYS A 57 ? ? -95.78 -62.08 167 14 ASN A 58 ? ? 176.96 68.46 168 14 ILE A 68 ? ? -93.12 -69.99 169 14 LEU A 83 ? ? 61.59 93.33 170 14 LYS A 112 ? ? -86.97 34.44 171 14 LYS A 113 ? ? -148.59 -35.46 172 14 LEU A 117 ? ? -98.88 -60.53 173 14 SER A 140 ? ? 59.74 70.30 174 14 ALA A 142 ? ? -120.85 -66.43 175 14 HIS A 145 ? ? -159.23 30.39 176 15 SER A 2 ? ? 61.56 -169.62 177 15 LYS A 3 ? ? 60.96 -101.47 178 15 ALA A 5 ? ? 67.94 128.73 179 15 LEU A 117 ? ? -75.38 -70.30 180 15 PRO A 124 ? ? -86.54 -159.58 181 15 SER A 140 ? ? -110.86 78.38 182 16 SER A 2 ? ? -167.03 -70.28 183 16 PRO A 6 ? ? -73.76 39.59 184 16 ALA A 7 ? ? 75.27 113.65 185 16 LYS A 57 ? ? -96.19 -66.16 186 16 ASN A 58 ? ? 174.63 18.59 187 16 PRO A 67 ? ? -62.26 -138.45 188 16 ILE A 68 ? ? 78.90 -49.36 189 16 LEU A 83 ? ? 63.62 95.28 190 16 LYS A 112 ? ? -144.63 -2.79 191 16 ILE A 116 ? ? 62.90 91.67 192 17 SER A 2 ? ? 69.39 93.39 193 17 LYS A 3 ? ? 66.42 168.99 194 17 ALA A 5 ? ? 63.04 103.77 195 17 LYS A 57 ? ? -121.16 -65.40 196 17 ASN A 58 ? ? 171.17 19.68 197 17 PRO A 67 ? ? -64.90 95.79 198 17 ILE A 68 ? ? -128.13 -65.01 199 17 LYS A 112 ? ? -67.68 86.15 200 17 LYS A 113 ? ? 165.73 -30.02 201 17 LEU A 117 ? ? -103.14 -68.59 202 17 HIS A 145 ? ? 64.30 -83.45 203 17 HIS A 146 ? ? -168.82 44.03 204 17 HIS A 147 ? ? 75.95 -45.86 205 18 LYS A 3 ? ? 65.95 163.74 206 18 THR A 4 ? ? 74.94 -0.33 207 18 ALA A 5 ? ? 175.42 168.49 208 18 PRO A 6 ? ? -69.74 24.93 209 18 LEU A 13 ? ? -79.06 20.70 210 18 LYS A 57 ? ? -71.35 -70.35 211 18 ASN A 58 ? ? 171.63 22.24 212 18 PRO A 67 ? ? -70.90 42.40 213 18 LEU A 117 ? ? -121.28 -61.06 214 18 GLU A 123 ? ? -167.09 116.57 215 18 ASP A 141 ? ? 66.25 -80.43 216 18 ALA A 142 ? ? -178.31 -33.88 217 18 HIS A 148 ? ? 70.01 -68.42 218 18 HIS A 149 ? ? 179.33 -36.99 219 19 SER A 2 ? ? 63.07 -74.45 220 19 THR A 4 ? ? 47.90 77.39 221 19 ALA A 5 ? ? 65.80 118.74 222 19 ASN A 58 ? ? 164.03 12.13 223 19 PRO A 67 ? ? -66.19 82.08 224 19 LYS A 112 ? ? -74.97 21.49 225 19 LYS A 113 ? ? -150.59 11.31 226 19 HIS A 149 ? ? 177.66 -34.96 227 20 ALA A 5 ? ? 64.01 96.07 228 20 PRO A 6 ? ? -77.53 35.35 229 20 ALA A 7 ? ? 57.16 84.90 230 20 LYS A 57 ? ? -98.68 -67.50 231 20 ASN A 58 ? ? 171.79 19.45 232 20 PRO A 67 ? ? -67.00 79.11 233 20 LYS A 93 ? ? 63.36 -24.96 234 20 ASN A 139 ? ? 51.65 -89.81 235 20 ASP A 141 ? ? 72.31 -40.07 236 20 HIS A 146 ? ? -175.81 102.33 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 12 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 90 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ALA _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 91 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -146.94 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'New York SGX Research Center for Structural Genomics' 1 NYSGXRC 'PSI, Protein Structure Initiative' 'New York Structural Genomics Research Consortium' 2 NYSGRC PSI:Biology # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L5O _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L5O _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] putative thioredoxin, 20 mM sodium phosphate, 100 mM sodium chloride, 1 mM DTT, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '1 mM putative thioredoxin, 20 mM sodium phosphate, 100 mM sodium chloride, 1 mM DTT, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'putative thioredoxin-1' 1 ? mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 DTT-4 1 ? mM ? 1 'putative thioredoxin-5' 1 ? mM ? 2 'sodium phosphate-6' 20 ? mM ? 2 'sodium chloride-7' 100 ? mM ? 2 DTT-8 1 ? mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '15N HSQC' 1 2 1 '15N NOESY-HSQC' 1 3 2 '13C HSQC' 1 4 2 'aromatic 13C HSQC' 1 5 2 '13C NOESY-HSQC' 1 6 2 '13C aromatic NOESY-HSQC' 1 7 1 HNCO 1 8 1 HNCACO 1 9 1 HNCA 1 10 1 HNCOCA 1 11 1 HNCACB 1 12 1 CBCACONH # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2L5O _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 45 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1813 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 579 _pdbx_nmr_constraints.NOE_long_range_total_count 508 _pdbx_nmr_constraints.NOE_medium_range_total_count 270 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 418 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 97 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 97 # _pdbx_nmr_refine.entry_id 2L5O _pdbx_nmr_refine.method 'simulating annealing' _pdbx_nmr_refine.details 'Refinement in a box of water' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger A. T. et.al.' refinement CNS 1.21 1 CCPN 'data analysis' CCPN_Analysis 2.1.2 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A LEU 0 ? A LEU 3 4 2 Y 1 A MET -2 ? A MET 1 5 2 Y 1 A SER -1 ? A SER 2 6 2 Y 1 A LEU 0 ? A LEU 3 7 3 Y 1 A MET -2 ? A MET 1 8 3 Y 1 A SER -1 ? A SER 2 9 3 Y 1 A LEU 0 ? A LEU 3 10 4 Y 1 A MET -2 ? A MET 1 11 4 Y 1 A SER -1 ? A SER 2 12 4 Y 1 A LEU 0 ? A LEU 3 13 5 Y 1 A MET -2 ? A MET 1 14 5 Y 1 A SER -1 ? A SER 2 15 5 Y 1 A LEU 0 ? A LEU 3 16 6 Y 1 A MET -2 ? A MET 1 17 6 Y 1 A SER -1 ? A SER 2 18 6 Y 1 A LEU 0 ? A LEU 3 19 7 Y 1 A MET -2 ? A MET 1 20 7 Y 1 A SER -1 ? A SER 2 21 7 Y 1 A LEU 0 ? A LEU 3 22 8 Y 1 A MET -2 ? A MET 1 23 8 Y 1 A SER -1 ? A SER 2 24 8 Y 1 A LEU 0 ? A LEU 3 25 9 Y 1 A MET -2 ? A MET 1 26 9 Y 1 A SER -1 ? A SER 2 27 9 Y 1 A LEU 0 ? A LEU 3 28 10 Y 1 A MET -2 ? A MET 1 29 10 Y 1 A SER -1 ? A SER 2 30 10 Y 1 A LEU 0 ? A LEU 3 31 11 Y 1 A MET -2 ? A MET 1 32 11 Y 1 A SER -1 ? A SER 2 33 11 Y 1 A LEU 0 ? A LEU 3 34 12 Y 1 A MET -2 ? A MET 1 35 12 Y 1 A SER -1 ? A SER 2 36 12 Y 1 A LEU 0 ? A LEU 3 37 13 Y 1 A MET -2 ? A MET 1 38 13 Y 1 A SER -1 ? A SER 2 39 13 Y 1 A LEU 0 ? A LEU 3 40 14 Y 1 A MET -2 ? A MET 1 41 14 Y 1 A SER -1 ? A SER 2 42 14 Y 1 A LEU 0 ? A LEU 3 43 15 Y 1 A MET -2 ? A MET 1 44 15 Y 1 A SER -1 ? A SER 2 45 15 Y 1 A LEU 0 ? A LEU 3 46 16 Y 1 A MET -2 ? A MET 1 47 16 Y 1 A SER -1 ? A SER 2 48 16 Y 1 A LEU 0 ? A LEU 3 49 17 Y 1 A MET -2 ? A MET 1 50 17 Y 1 A SER -1 ? A SER 2 51 17 Y 1 A LEU 0 ? A LEU 3 52 18 Y 1 A MET -2 ? A MET 1 53 18 Y 1 A SER -1 ? A SER 2 54 18 Y 1 A LEU 0 ? A LEU 3 55 19 Y 1 A MET -2 ? A MET 1 56 19 Y 1 A SER -1 ? A SER 2 57 19 Y 1 A LEU 0 ? A LEU 3 58 20 Y 1 A MET -2 ? A MET 1 59 20 Y 1 A SER -1 ? A SER 2 60 20 Y 1 A LEU 0 ? A LEU 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 600 Bruker DRX 2 'Bruker DRX' 500 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2L5O _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_