data_2L60 # _entry.id 2L60 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L60 RCSB RCSB102000 BMRB 17291 WWPDB D_1000102000 # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 17291 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L60 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pedersen, N.L.' 1 'Jurt, S.' 2 'Zerbe, O.' 3 'Jensen, K.J.' 4 # _citation.id primary _citation.title 'A novel design concept: New Y-receptor agonists with increased membrane recruitment, Y2 affinity and selectivity' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pedersen, N.L.' 1 ? primary 'Jurt, S.' 2 ? primary 'Zerbe, O.' 3 ? primary 'Jensen, K.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Peptide YY' _entity.formula_weight 5121.941 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 41-64' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PYY, PYY-I, Peptide tyrosine tyrosine, Peptide YY(3-36), PYY-II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'YLERELKKLERELKKLSPEELNRYYASLRHYLNLVTRQRY(NH2)' _entity_poly.pdbx_seq_one_letter_code_can YLERELKKLERELKKLSPEELNRYYASLRHYLNLVTRQRYX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TYR n 1 2 LEU n 1 3 GLU n 1 4 ARG n 1 5 GLU n 1 6 LEU n 1 7 LYS n 1 8 LYS n 1 9 LEU n 1 10 GLU n 1 11 ARG n 1 12 GLU n 1 13 LEU n 1 14 LYS n 1 15 LYS n 1 16 LEU n 1 17 SER n 1 18 PRO n 1 19 GLU n 1 20 GLU n 1 21 LEU n 1 22 ASN n 1 23 ARG n 1 24 TYR n 1 25 TYR n 1 26 ALA n 1 27 SER n 1 28 LEU n 1 29 ARG n 1 30 HIS n 1 31 TYR n 1 32 LEU n 1 33 ASN n 1 34 LEU n 1 35 VAL n 1 36 THR n 1 37 ARG n 1 38 GLN n 1 39 ARG n 1 40 TYR n 1 41 NH2 n # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 PDB 2L60 2L60 1 YLERELKKLERELKKL 1 ? 2 UNP PYY_HUMAN P10082 1 SPEELNRYYASLRHYLNLVTRQRY 41 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2L60 A 1 ? 16 ? 2L60 1 ? 16 ? 1 16 2 2 2L60 A 17 ? 40 ? P10082 41 ? 64 ? 17 40 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 2L60 _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 41 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P10082 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details amidation _struct_ref_seq_dif.pdbx_auth_seq_num 41 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 NOESY 1 2 1 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM entity, 1 mM RNH, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L60 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L60 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L60 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'P.GUNTERT ET AL.' 'structure solution' CYANA 3.0 1 'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, ... and Kollm' refinement Amber 6 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;Structure of a (3-36)PYY mutant for improved membrane-binding affinity and improved Y2 receptor binding in presence of a membrane model (DPC) ; _exptl.entry_id 2L60 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L60 _struct.title 'A novel design concept: New Y-receptor agonists with increased membrane recruitment, Y2 affinity and selectivity' _struct.pdbx_descriptor 'Peptide YY' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L60 _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'GPCR ligand, HORMONE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 2 ? LYS A 14 ? LEU A 2 LYS A 14 1 ? 13 HELX_P HELX_P2 2 SER A 17 ? THR A 36 ? SER A 17 THR A 36 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id TYR _struct_conn.ptnr1_label_seq_id 40 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 41 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id TYR _struct_conn.ptnr1_auth_seq_id 40 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 41 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.323 _struct_conn.pdbx_value_order ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 2L60 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TYR 1 1 1 TYR TYR A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 NH2 41 41 41 NH2 NH2 A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-05 2 'Structure model' 1 1 2020-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_status 2 2 'Structure model' pdbx_nmr_software 3 2 'Structure model' pdbx_nmr_spectrometer 4 2 'Structure model' struct_conn 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code_cs' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 2 'Structure model' '_pdbx_nmr_spectrometer.model' 4 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_entry_details.entry_id 2L60 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;THE DEPOSITED SEQUENCE IS A DESIGNED VARIANT OF THE PEPTIDE PYY. THE C-TERMINAL RESIDUES CORRESPOND TO THE SEQUENCE OF HUMAN PYY, THE N-TERMINAL SEGMENT WAS REPLACED WITH A DESIGNED SEQUENCE. ; _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1-1 1 ? mM ? 1 RNH-2 1 ? mM ? 1 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 5 O A LEU 32 ? ? HG1 A THR 36 ? ? 1.57 2 14 OE1 A GLN 38 ? ? HH A TYR 40 ? ? 1.55 3 14 O A LEU 32 ? ? HG1 A THR 36 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -118.77 56.48 2 1 ARG A 39 ? ? -157.94 63.56 3 2 LEU A 34 ? ? -141.41 12.69 4 2 ARG A 39 ? ? -167.76 71.29 5 3 LEU A 2 ? ? 71.20 -62.66 6 4 VAL A 35 ? ? -120.82 -112.37 7 5 LEU A 2 ? ? -160.49 -61.09 8 5 GLU A 3 ? ? -48.44 -70.71 9 5 GLU A 12 ? ? -77.29 -73.31 10 5 THR A 36 ? ? -43.75 -16.61 11 5 GLN A 38 ? ? 57.53 13.01 12 5 ARG A 39 ? ? -163.36 70.38 13 6 VAL A 35 ? ? -118.36 -106.56 14 6 ARG A 39 ? ? -175.30 69.67 15 7 LEU A 2 ? ? 75.29 -48.11 16 8 LEU A 2 ? ? 74.27 67.31 17 8 LYS A 14 ? ? -59.97 -8.80 18 8 LEU A 16 ? ? -83.23 36.82 19 8 SER A 17 ? ? 57.99 145.07 20 8 ARG A 39 ? ? -156.10 64.23 21 9 SER A 17 ? ? 70.59 139.74 22 9 ARG A 39 ? ? -174.75 68.50 23 10 SER A 17 ? ? 67.98 143.75 24 11 GLU A 5 ? ? 82.34 -36.54 25 11 ARG A 39 ? ? -163.35 74.14 26 12 LEU A 16 ? ? -108.85 46.39 27 12 SER A 17 ? ? 55.27 139.61 28 12 VAL A 35 ? ? -131.39 -107.00 29 13 ARG A 39 ? ? -160.20 76.58 30 14 TYR A 31 ? ? -58.94 -80.14 31 14 ARG A 37 ? ? 82.00 37.71 32 15 VAL A 35 ? ? -132.24 -111.81 33 16 LEU A 2 ? ? -69.35 71.20 34 16 SER A 17 ? ? 54.09 152.86 35 16 VAL A 35 ? ? -139.82 -109.82 36 17 GLU A 5 ? ? 88.33 -46.34 37 19 GLU A 3 ? ? -128.98 -64.88 38 20 LEU A 2 ? ? 59.19 75.83 39 20 SER A 17 ? ? 59.88 137.86 40 20 ARG A 39 ? ? -164.50 65.15 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 7 TYR A 40 ? ? 0.092 'SIDE CHAIN' 2 13 TYR A 1 ? ? 0.070 'SIDE CHAIN' 3 15 TYR A 40 ? ? 0.078 'SIDE CHAIN' #