data_2L69 # _entry.id 2L69 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L69 pdb_00002l69 10.2210/pdb2l69/pdb RCSB RCSB102009 ? ? BMRB 17304 ? ? WWPDB D_1000102009 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17304 BMRB unspecified . OR28 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L69 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Koga, N.' 2 'Koga, R.' 3 'Xiao, R.' 4 'Mao, A.' 5 'Mao, B.' 6 'Patel, D.' 7 'Ciccosanti, C.' 8 'Hamilton, K.' 9 'Acton, T.B.' 10 'Baker, D.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title 'Solution NMR structure of de novo designed rossmann 2x3 fold protein, Northeast Structural Genomics Consortium Target OR28' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Koga, N.' 2 ? primary 'Koga, R.' 3 ? primary 'Xiao, R.' 4 ? primary 'Mao, L.' 5 ? primary 'Patel, D.' 6 ? primary 'Ciccosanti, C.' 7 ? primary 'Hamilton, A.' 8 ? primary 'Mao, B.' 9 ? primary 'Acton, T.B.' 10 ? primary 'Baker, D.' 11 ? primary 'Montelione, G.T.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Rossmann 2x3 fold protein' _entity.formula_weight 15857.213 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNIVIVVFSTDEETLRKFKDIIKKNGFKVRTVRSPQELKDSIEELVKKYNATIVVVVVDDKEWAEKAIRFVKSLGAQVLI IIYDQDQNRLEEFSREVRRRGFEVRTVTSPDDFKKSLERLIREVGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNIVIVVFSTDEETLRKFKDIIKKNGFKVRTVRSPQELKDSIEELVKKYNATIVVVVVDDKEWAEKAIRFVKSLGAQVLI IIYDQDQNRLEEFSREVRRRGFEVRTVTSPDDFKKSLERLIREVGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier OR28 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ILE n 1 4 VAL n 1 5 ILE n 1 6 VAL n 1 7 VAL n 1 8 PHE n 1 9 SER n 1 10 THR n 1 11 ASP n 1 12 GLU n 1 13 GLU n 1 14 THR n 1 15 LEU n 1 16 ARG n 1 17 LYS n 1 18 PHE n 1 19 LYS n 1 20 ASP n 1 21 ILE n 1 22 ILE n 1 23 LYS n 1 24 LYS n 1 25 ASN n 1 26 GLY n 1 27 PHE n 1 28 LYS n 1 29 VAL n 1 30 ARG n 1 31 THR n 1 32 VAL n 1 33 ARG n 1 34 SER n 1 35 PRO n 1 36 GLN n 1 37 GLU n 1 38 LEU n 1 39 LYS n 1 40 ASP n 1 41 SER n 1 42 ILE n 1 43 GLU n 1 44 GLU n 1 45 LEU n 1 46 VAL n 1 47 LYS n 1 48 LYS n 1 49 TYR n 1 50 ASN n 1 51 ALA n 1 52 THR n 1 53 ILE n 1 54 VAL n 1 55 VAL n 1 56 VAL n 1 57 VAL n 1 58 VAL n 1 59 ASP n 1 60 ASP n 1 61 LYS n 1 62 GLU n 1 63 TRP n 1 64 ALA n 1 65 GLU n 1 66 LYS n 1 67 ALA n 1 68 ILE n 1 69 ARG n 1 70 PHE n 1 71 VAL n 1 72 LYS n 1 73 SER n 1 74 LEU n 1 75 GLY n 1 76 ALA n 1 77 GLN n 1 78 VAL n 1 79 LEU n 1 80 ILE n 1 81 ILE n 1 82 ILE n 1 83 TYR n 1 84 ASP n 1 85 GLN n 1 86 ASP n 1 87 GLN n 1 88 ASN n 1 89 ARG n 1 90 LEU n 1 91 GLU n 1 92 GLU n 1 93 PHE n 1 94 SER n 1 95 ARG n 1 96 GLU n 1 97 VAL n 1 98 ARG n 1 99 ARG n 1 100 ARG n 1 101 GLY n 1 102 PHE n 1 103 GLU n 1 104 VAL n 1 105 ARG n 1 106 THR n 1 107 VAL n 1 108 THR n 1 109 SER n 1 110 PRO n 1 111 ASP n 1 112 ASP n 1 113 PHE n 1 114 LYS n 1 115 LYS n 1 116 SER n 1 117 LEU n 1 118 GLU n 1 119 ARG n 1 120 LEU n 1 121 ILE n 1 122 ARG n 1 123 GLU n 1 124 VAL n 1 125 GLY n 1 126 SER n 1 127 LEU n 1 128 GLU n 1 129 HIS n 1 130 HIS n 1 131 HIS n 1 132 HIS n 1 133 HIS n 1 134 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2L69 _struct_ref.pdbx_db_accession 2L69 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L69 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2L69 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.62 mM [U-100% 13C; U-100% 15N] OR28, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.47 mM [U-5% 13C; U-100% 15N] OR28, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L69 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L69 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L69 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 12 'Bruker Biospin' collection TopSpin ? 13 Varian collection VnmrJ ? 14 'Yang Shen' 'data analysis' UBNMR 1.3 15 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 16 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L69 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L69 _struct.title 'Solution NMR Structure of de novo designed protein, P-loop NTPase fold, Northeast Structural Genomics Consortium Target OR28' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L69 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text ;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, Unknown function, DE NOVO PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? ASN A 25 ? ASP A 11 ASN A 25 1 ? 15 HELX_P HELX_P2 2 SER A 34 ? VAL A 46 ? SER A 34 VAL A 46 1 ? 13 HELX_P HELX_P3 3 ASP A 60 ? GLY A 75 ? ASP A 60 GLY A 75 1 ? 16 HELX_P HELX_P4 4 ASP A 86 ? ARG A 100 ? ASP A 86 ARG A 100 1 ? 15 HELX_P HELX_P5 5 SER A 109 ? GLY A 125 ? SER A 109 GLY A 125 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 28 ? VAL A 32 ? LYS A 28 VAL A 32 A 2 THR A 52 ? VAL A 57 ? THR A 52 VAL A 57 A 3 ILE A 3 ? VAL A 7 ? ILE A 3 VAL A 7 A 4 LEU A 79 ? TYR A 83 ? LEU A 79 TYR A 83 A 5 VAL A 104 ? VAL A 107 ? VAL A 104 VAL A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 28 ? N LYS A 28 O ILE A 53 ? O ILE A 53 A 2 3 O VAL A 54 ? O VAL A 54 N ILE A 5 ? N ILE A 5 A 3 4 N VAL A 4 ? N VAL A 4 O LEU A 79 ? O LEU A 79 A 4 5 N ILE A 80 ? N ILE A 80 O ARG A 105 ? O ARG A 105 # _atom_sites.entry_id 2L69 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 PHE 18 18 18 PHE PHE A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 TRP 63 63 63 TRP TRP A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 ARG 119 119 119 ARG ARG A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 HIS 134 134 134 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-01-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-02-22 4 'Structure model' 1 3 2020-02-05 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' Other 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_database_status 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' database_2 5 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_pdbx_nmr_spectrometer.model' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id OR28-1 0.62 ? mM '[U-100% 13C; U-100% 15N]' 1 OR28-2 0.47 ? mM '[U-5% 13C; U-100% 15N]' 2 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 15 _pdbx_validate_close_contact.auth_atom_id_1 HD13 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 79 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HH11 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 105 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.33 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 51 ? ? -61.40 92.32 2 1 HIS A 130 ? ? 63.36 -78.43 3 1 HIS A 131 ? ? -62.66 97.09 4 2 ASN A 2 ? ? -174.94 129.74 5 2 ALA A 51 ? ? -98.59 30.16 6 2 ASP A 59 ? ? -148.63 -33.67 7 2 HIS A 129 ? ? -57.36 106.46 8 3 SER A 9 ? ? 176.42 109.75 9 3 HIS A 129 ? ? -158.40 73.63 10 4 THR A 10 ? ? 66.04 -60.92 11 4 LYS A 48 ? ? -105.95 -78.72 12 4 HIS A 129 ? ? -127.30 -62.41 13 4 HIS A 130 ? ? -169.98 107.48 14 4 HIS A 131 ? ? 71.57 -31.26 15 5 SER A 9 ? ? -163.08 113.26 16 5 ASP A 60 ? ? -136.44 -158.57 17 5 GLU A 128 ? ? -59.73 99.10 18 6 PHE A 8 ? ? -86.31 43.90 19 6 GLU A 128 ? ? -113.20 79.03 20 7 ASN A 50 ? ? -87.53 -93.62 21 7 ALA A 51 ? ? 51.24 19.69 22 7 HIS A 129 ? ? 58.67 4.20 23 7 HIS A 132 ? ? 68.05 73.85 24 8 ASN A 2 ? ? -67.04 74.14 25 8 PHE A 8 ? ? -86.71 36.89 26 8 LYS A 47 ? ? -108.96 -60.22 27 8 TYR A 49 ? ? -134.57 -158.97 28 8 ASN A 50 ? ? 77.35 -89.36 29 8 HIS A 129 ? ? -163.18 56.57 30 10 LYS A 47 ? ? -72.76 -73.23 31 11 SER A 9 ? ? -68.48 99.58 32 11 LEU A 127 ? ? -148.02 -45.38 33 11 GLU A 128 ? ? -78.98 44.86 34 12 LYS A 47 ? ? -82.05 -83.27 35 12 HIS A 130 ? ? -156.29 19.03 36 12 HIS A 133 ? ? -114.17 -169.52 37 13 ASN A 2 ? ? 72.54 101.36 38 13 ASN A 50 ? ? -67.43 -173.20 39 13 HIS A 129 ? ? -65.04 96.82 40 13 HIS A 130 ? ? -42.71 -72.65 41 14 TYR A 49 ? ? 69.28 -65.96 42 14 ASN A 50 ? ? -54.56 -130.41 43 14 ASP A 59 ? ? -94.65 -64.17 44 14 SER A 126 ? ? -60.75 -74.50 45 14 HIS A 129 ? ? -93.46 33.20 46 14 HIS A 130 ? ? 50.79 77.37 47 15 ASN A 2 ? ? 179.75 165.11 48 15 SER A 9 ? ? -168.37 103.41 49 15 LEU A 127 ? ? -162.63 12.71 50 15 HIS A 130 ? ? -58.31 99.91 51 16 ASN A 2 ? ? -153.81 -47.70 52 16 LYS A 47 ? ? -121.88 -83.37 53 16 LYS A 48 ? ? -172.37 141.28 54 16 TYR A 49 ? ? 176.89 176.57 55 17 GLU A 128 ? ? -67.77 99.36 56 18 ASN A 2 ? ? -171.52 143.04 57 18 THR A 10 ? ? -83.47 39.09 58 18 LYS A 47 ? ? -92.15 -69.46 59 18 ALA A 51 ? ? -65.72 75.28 60 18 HIS A 131 ? ? -86.92 30.46 61 18 HIS A 132 ? ? -64.82 99.51 62 19 THR A 10 ? ? 67.53 -59.76 63 19 ARG A 33 ? ? -140.79 -2.70 64 19 ASP A 59 ? ? -150.59 -40.66 65 20 THR A 10 ? ? 74.97 -46.00 66 20 ALA A 51 ? ? -58.07 91.27 67 20 SER A 126 ? ? -81.79 37.25 68 20 GLU A 128 ? ? 69.10 -62.28 #