data_2L6W # _entry.id 2L6W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2L6W RCSB RCSB102032 WWPDB D_1000102032 # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L6W _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-11-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Muhle-Goll, C.' 1 'Hoffmann, S.' 2 'Ulrich, A.S.' 3 # _citation.id primary _citation.title ;Hydrophobic matching controls the tilt and stability of the dimeric platelet-derived growth factor receptor (PDGFR) beta transmembrane segment. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 287 _citation.page_first 26178 _citation.page_last 26186 _citation.year 2012 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22619173 _citation.pdbx_database_id_DOI 10.1074/jbc.M111.325555 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Muhle-Goll, C.' 1 primary 'Hoffmann, S.' 2 primary 'Afonin, S.' 3 primary 'Grage, S.L.' 4 primary 'Polyansky, A.A.' 5 primary 'Windisch, D.' 6 primary 'Zeitler, M.' 7 primary 'Burck, J.' 8 primary 'Ulrich, A.S.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Beta-type platelet-derived growth factor receptor' _entity.formula_weight 4421.528 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec 2.7.10.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 526-563' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PDGF-R-beta, CD140 antigen-like family member B' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE _entity_poly.pdbx_seq_one_letter_code_can GHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 SER n 1 4 LEU n 1 5 PRO n 1 6 PHE n 1 7 LYS n 1 8 VAL n 1 9 VAL n 1 10 VAL n 1 11 ILE n 1 12 SER n 1 13 ALA n 1 14 ILE n 1 15 LEU n 1 16 ALA n 1 17 LEU n 1 18 VAL n 1 19 VAL n 1 20 LEU n 1 21 THR n 1 22 ILE n 1 23 ILE n 1 24 SER n 1 25 LEU n 1 26 ILE n 1 27 ILE n 1 28 LEU n 1 29 ILE n 1 30 MET n 1 31 LEU n 1 32 TRP n 1 33 GLN n 1 34 LYS n 1 35 LYS n 1 36 PRO n 1 37 ARG n 1 38 TYR n 1 39 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PDGFRB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL 21' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pMMHb _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PGFRB_HUMAN _struct_ref.pdbx_db_accession P09619 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code HSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYE _struct_ref.pdbx_align_begin 526 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2L6W A 2 ? 39 ? P09619 526 ? 563 ? 2 39 2 1 2L6W B 2 ? 39 ? P09619 526 ? 563 ? 2 39 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L6W GLY A 1 ? UNP P09619 ? ? 'EXPRESSION TAG' 1 1 2 2L6W GLY B 1 ? UNP P09619 ? ? 'EXPRESSION TAG' 1 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N TOCSY' 1 2 1 '3D 1H-15N NOESY' 2 3 1 '3D 1H-15N NOESY' 1 4 2 '3D HNCACB' 1 5 2 '3D HNCA' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D C(CO)NH' 1 8 4 '3D 1H-13C NOESY' 2 9 4 '3D 1H-13C NOESY' 2 10 3 '3D 13C-filtered 13C-edited NOESY' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 120 6.8 ambient ? 323 K 2 120 6.8 ambient ? 310 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 15N] PDGFR-TM, 200 mM [U-2H] DPC, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] PDGFR-TM, 200 mM [U-2H] DPC, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] and natural abundance PDGFR-TM, 200 mM DPC, 100% D2O' 3 '100% D2O' '1 mM [U-100% 13C; U-100% 15N] PDGFR-TM, 200 mM [U-2H] DPC, 100% D2O' 4 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 900 Bruker Avance 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2L6W _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L6W _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L6W _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 3 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.2 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'transmembrane helix of the platelet derived growth factor receptor beta' _exptl.entry_id 2L6W _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L6W _struct.title 'PDGFR beta-TM' _struct.pdbx_descriptor 'Beta-type platelet-derived growth factor receptor (E.C.2.7.10.1)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L6W _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'transmembrane helix, receptor tyrosine kinase, heptad repeat, MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 5 ? GLN A 33 ? PRO A 5 GLN A 33 1 ? 29 HELX_P HELX_P2 2 PRO B 5 ? LYS B 34 ? PRO B 5 LYS B 34 1 ? 30 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2L6W _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 HIS 2 2 2 HIS HIS A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 TRP 32 32 32 TRP TRP A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 GLU 39 39 39 GLU GLU A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 HIS 2 2 2 HIS HIS B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 LEU 4 4 4 LEU LEU B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 PHE 6 6 6 PHE PHE B . n B 1 7 LYS 7 7 7 LYS LYS B . n B 1 8 VAL 8 8 8 VAL VAL B . n B 1 9 VAL 9 9 9 VAL VAL B . n B 1 10 VAL 10 10 10 VAL VAL B . n B 1 11 ILE 11 11 11 ILE ILE B . n B 1 12 SER 12 12 12 SER SER B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 ILE 14 14 14 ILE ILE B . n B 1 15 LEU 15 15 15 LEU LEU B . n B 1 16 ALA 16 16 16 ALA ALA B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 VAL 18 18 18 VAL VAL B . n B 1 19 VAL 19 19 19 VAL VAL B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 THR 21 21 21 THR THR B . n B 1 22 ILE 22 22 22 ILE ILE B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 SER 24 24 24 SER SER B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ILE 26 26 26 ILE ILE B . n B 1 27 ILE 27 27 27 ILE ILE B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 ILE 29 29 29 ILE ILE B . n B 1 30 MET 30 30 30 MET MET B . n B 1 31 LEU 31 31 31 LEU LEU B . n B 1 32 TRP 32 32 32 TRP TRP B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 LYS 34 34 34 LYS LYS B . n B 1 35 LYS 35 35 35 LYS LYS B . n B 1 36 PRO 36 36 36 PRO PRO B . n B 1 37 ARG 37 37 37 ARG ARG B . n B 1 38 TYR 38 38 38 TYR TYR B . n B 1 39 GLU 39 39 39 GLU GLU B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-30 2 'Structure model' 1 1 2014-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id PDGFR-TM-1 1 ? mM '[U-100% 15N]' 1 DPC-2 200 ? mM '[U-2H]' 1 PDGFR-TM-3 1 ? mM '[U-100% 13C; U-100% 15N]' 2 DPC-4 200 ? mM '[U-2H]' 2 PDGFR-TM-5 1 ? mM '[U-100% 13C; U-100% 15N] and natural abundance' 3 DPC-6 200 ? mM ? 3 PDGFR-TM-7 1 ? mM '[U-100% 13C; U-100% 15N]' 4 DPC-8 200 ? mM '[U-2H]' 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 2 ? ? -130.02 -36.89 2 1 SER A 3 ? ? -134.85 -76.08 3 1 SER B 3 ? ? -136.00 -73.61 4 1 LYS B 34 ? ? 58.44 -85.59 5 2 HIS A 2 ? ? 59.37 98.55 6 3 HIS A 2 ? ? -94.67 -69.68 7 5 HIS B 2 ? ? 59.53 93.07 8 5 SER B 3 ? ? 60.39 105.60 9 6 SER A 3 ? ? -144.26 -12.54 10 6 LYS A 34 ? ? 60.90 -85.61 11 7 HIS A 2 ? ? -94.72 -65.69 12 7 SER A 3 ? ? 57.79 92.62 13 7 LYS A 34 ? ? -141.85 -2.51 14 8 HIS B 2 ? ? 57.36 -168.29 15 8 SER B 3 ? ? 59.29 -172.07 16 9 SER B 3 ? ? -95.71 -70.01 17 11 HIS A 2 ? ? -139.92 -63.03 18 11 HIS B 2 ? ? -128.51 -67.95 19 12 LYS A 34 ? ? 61.21 -86.45 20 13 LYS A 34 ? ? 59.49 -87.34 21 13 HIS B 2 ? ? 60.61 102.53 22 14 LYS B 34 ? ? 62.10 -84.15 23 15 SER B 3 ? ? -156.23 -39.04 24 15 LYS B 34 ? ? 55.82 -165.70 25 17 SER A 3 ? ? 63.13 -82.20 26 17 LYS A 34 ? ? -120.39 -66.86 27 17 HIS B 2 ? ? -108.98 -61.99 28 18 HIS A 2 ? ? 58.68 17.42 29 18 LYS A 34 ? ? 58.23 -85.88 30 18 HIS B 2 ? ? -152.68 -7.06 31 19 HIS A 2 ? ? 59.51 11.22 32 19 SER A 3 ? ? 59.34 99.03 33 20 HIS A 2 ? ? 57.03 -175.79 34 20 SER A 3 ? ? -163.03 -1.28 #