data_2L82 # _entry.id 2L82 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L82 pdb_00002l82 10.2210/pdb2l82/pdb RCSB RCSB102073 ? ? BMRB 17390 ? ? WWPDB D_1000102073 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17390 BMRB unspecified . OR32 TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L82 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2010-12-31 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Koga, N.' 2 'Koga, R.' 3 'Xiao, R.' 4 'Hamilton, K.' 5 'Janjua, H.' 6 'Tong, S.' 7 'Acton, T.B.' 8 'Everett, J.' 9 'Baker, D.' 10 'Montelione, G.T.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target OR32' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Koga, N.' 2 ? primary 'Koga, R.' 3 ? primary 'Xiao, R.' 4 ? primary 'Hamilton, K.' 5 ? primary 'Janjua, H.' 6 ? primary 'Tong, S.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Everett, J.' 9 ? primary 'Baker, D.' 10 ? primary 'Montelione, G.T.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DESIGNED PROTEIN OR32' _entity.formula_weight 19701.045 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSQIFVVFSSDPEILKEIVREIKRQGVRVVLLYSDQDEKRRRERLEEFEKQGVDVRTVEDKEDFRENIREIWERYPQLDV VVIVTTDDKEWIKDFIEEAKERGVEVFVVYNNKDDDRRKEAQQEFRSDGVDVRTVSDKEELIEQVRRFVRKVGSLEHHHH HH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSQIFVVFSSDPEILKEIVREIKRQGVRVVLLYSDQDEKRRRERLEEFEKQGVDVRTVEDKEDFRENIREIWERYPQLDV VVIVTTDDKEWIKDFIEEAKERGVEVFVVYNNKDDDRRKEAQQEFRSDGVDVRTVSDKEELIEQVRRFVRKVGSLEHHHH HH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier OR32 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLN n 1 4 ILE n 1 5 PHE n 1 6 VAL n 1 7 VAL n 1 8 PHE n 1 9 SER n 1 10 SER n 1 11 ASP n 1 12 PRO n 1 13 GLU n 1 14 ILE n 1 15 LEU n 1 16 LYS n 1 17 GLU n 1 18 ILE n 1 19 VAL n 1 20 ARG n 1 21 GLU n 1 22 ILE n 1 23 LYS n 1 24 ARG n 1 25 GLN n 1 26 GLY n 1 27 VAL n 1 28 ARG n 1 29 VAL n 1 30 VAL n 1 31 LEU n 1 32 LEU n 1 33 TYR n 1 34 SER n 1 35 ASP n 1 36 GLN n 1 37 ASP n 1 38 GLU n 1 39 LYS n 1 40 ARG n 1 41 ARG n 1 42 ARG n 1 43 GLU n 1 44 ARG n 1 45 LEU n 1 46 GLU n 1 47 GLU n 1 48 PHE n 1 49 GLU n 1 50 LYS n 1 51 GLN n 1 52 GLY n 1 53 VAL n 1 54 ASP n 1 55 VAL n 1 56 ARG n 1 57 THR n 1 58 VAL n 1 59 GLU n 1 60 ASP n 1 61 LYS n 1 62 GLU n 1 63 ASP n 1 64 PHE n 1 65 ARG n 1 66 GLU n 1 67 ASN n 1 68 ILE n 1 69 ARG n 1 70 GLU n 1 71 ILE n 1 72 TRP n 1 73 GLU n 1 74 ARG n 1 75 TYR n 1 76 PRO n 1 77 GLN n 1 78 LEU n 1 79 ASP n 1 80 VAL n 1 81 VAL n 1 82 VAL n 1 83 ILE n 1 84 VAL n 1 85 THR n 1 86 THR n 1 87 ASP n 1 88 ASP n 1 89 LYS n 1 90 GLU n 1 91 TRP n 1 92 ILE n 1 93 LYS n 1 94 ASP n 1 95 PHE n 1 96 ILE n 1 97 GLU n 1 98 GLU n 1 99 ALA n 1 100 LYS n 1 101 GLU n 1 102 ARG n 1 103 GLY n 1 104 VAL n 1 105 GLU n 1 106 VAL n 1 107 PHE n 1 108 VAL n 1 109 VAL n 1 110 TYR n 1 111 ASN n 1 112 ASN n 1 113 LYS n 1 114 ASP n 1 115 ASP n 1 116 ASP n 1 117 ARG n 1 118 ARG n 1 119 LYS n 1 120 GLU n 1 121 ALA n 1 122 GLN n 1 123 GLN n 1 124 GLU n 1 125 PHE n 1 126 ARG n 1 127 SER n 1 128 ASP n 1 129 GLY n 1 130 VAL n 1 131 ASP n 1 132 VAL n 1 133 ARG n 1 134 THR n 1 135 VAL n 1 136 SER n 1 137 ASP n 1 138 LYS n 1 139 GLU n 1 140 GLU n 1 141 LEU n 1 142 ILE n 1 143 GLU n 1 144 GLN n 1 145 VAL n 1 146 ARG n 1 147 ARG n 1 148 PHE n 1 149 VAL n 1 150 ARG n 1 151 LYS n 1 152 VAL n 1 153 GLY n 1 154 SER n 1 155 LEU n 1 156 GLU n 1 157 HIS n 1 158 HIS n 1 159 HIS n 1 160 HIS n 1 161 HIS n 1 162 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'artificial gene' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET29b+ _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2L82 _struct_ref.pdbx_db_accession 2L82 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L82 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 162 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2L82 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.06 mM [U-100% 13C; U-100% 15N] OR32, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.85 mM [U-5% 13C; U-100% 15N] OR32, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2L82 _pdbx_nmr_refine.method 'distance geometry, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L82 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L82 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS ? 2 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS ? 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 3.0 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 3.0 5 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 3.0 6 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1 7 'Huang, Tejero, Powers and Montelione' refinement AutoStructure 2.1 8 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis' AutoAssign 2.1 9 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.1 10 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 11 'Bartels et al.' 'data analysis' XEASY ? 12 'Bartels et al.' 'peak picking' XEASY ? 13 'Bartels et al.' 'chemical shift assignment' XEASY ? 14 'Bruker Biospin' collection TopSpin ? 15 Varian collection VnmrJ ? 16 'Bahrami, Markley, Assadi, and Eghbalnia' 'chemical shift assignment' PINE ? 17 Goddard 'data analysis' Sparky ? 18 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 19 'PALES (Zweckstetter, Bax)' 'geometry optimization' PALES ? 20 'Valafar, Prestegard' 'geometry optimization' REDCAT ? 21 ? refinement CYANA ? 22 ? refinement CNS ? 23 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L82 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L82 _struct.title 'Solution NMR Structure of de novo designed protein, P-loop NTPase fold, Northeast Structural Genomics Consortium Target OR32' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L82 _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG) PSI-Biology, Protein Structure Initiative, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? GLN A 25 ? ASP A 11 GLN A 25 1 ? 15 HELX_P HELX_P2 2 ASP A 37 ? LYS A 50 ? ASP A 37 LYS A 50 1 ? 14 HELX_P HELX_P3 3 ASP A 60 ? TYR A 75 ? ASP A 60 TYR A 75 1 ? 16 HELX_P HELX_P4 4 ASP A 88 ? ARG A 102 ? ASP A 88 ARG A 102 1 ? 15 HELX_P HELX_P5 5 ASP A 114 ? ARG A 126 ? ASP A 114 ARG A 126 1 ? 13 HELX_P HELX_P6 6 ASP A 137 ? GLY A 153 ? ASP A 137 GLY A 153 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 54 ? THR A 57 ? ASP A 54 THR A 57 A 2 ARG A 28 ? TYR A 33 ? ARG A 28 TYR A 33 A 3 VAL A 80 ? THR A 85 ? VAL A 80 THR A 85 A 4 GLN A 3 ? SER A 9 ? GLN A 3 SER A 9 A 5 GLU A 105 ? ASN A 111 ? GLU A 105 ASN A 111 A 6 ASP A 131 ? VAL A 135 ? ASP A 131 VAL A 135 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 56 ? O ARG A 56 N LEU A 31 ? N LEU A 31 A 2 3 N LEU A 32 ? N LEU A 32 O ILE A 83 ? O ILE A 83 A 3 4 O VAL A 82 ? O VAL A 82 N VAL A 7 ? N VAL A 7 A 4 5 N VAL A 6 ? N VAL A 6 O VAL A 109 ? O VAL A 109 A 5 6 N VAL A 108 ? N VAL A 108 O ARG A 133 ? O ARG A 133 # _atom_sites.entry_id 2L82 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 TRP 72 72 72 TRP TRP A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ASP 137 137 137 ASP ASP A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ARG 146 146 146 ARG ARG A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 VAL 149 149 149 VAL VAL A . n A 1 150 ARG 150 150 150 ARG ARG A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 HIS 157 157 157 HIS HIS A . n A 1 158 HIS 158 158 158 HIS HIS A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 HIS 161 161 161 HIS HIS A . n A 1 162 HIS 162 162 162 HIS HIS A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-02-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id OR32-1 1.06 ? mM '[U-100% 13C; U-100% 15N]' 1 OR32-2 0.85 ? mM '[U-5% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 79 ? ? -75.82 39.16 2 1 ARG A 126 ? ? -59.85 109.16 3 1 SER A 127 ? ? -107.89 -169.43 4 1 SER A 154 ? ? -147.08 -63.20 5 1 LEU A 155 ? ? -132.29 -158.67 6 2 SER A 2 ? ? 63.46 60.85 7 2 ASP A 79 ? ? -75.74 25.65 8 2 HIS A 157 ? ? -164.07 81.87 9 3 SER A 2 ? ? -67.96 96.19 10 3 GLU A 59 ? ? -144.87 -36.36 11 3 ASP A 79 ? ? -76.06 38.91 12 4 SER A 2 ? ? -102.83 79.87 13 4 THR A 86 ? ? 178.07 166.35 14 4 ASP A 115 ? ? -126.76 -70.74 15 4 LEU A 155 ? ? -67.03 80.14 16 4 GLU A 156 ? ? 42.10 10.80 17 5 ASP A 79 ? ? -74.47 36.87 18 5 LEU A 155 ? ? 61.79 86.23 19 5 HIS A 157 ? ? -167.76 53.28 20 5 HIS A 158 ? ? -140.20 -71.70 21 5 HIS A 161 ? ? -76.68 31.20 22 6 ASP A 79 ? ? -78.40 40.30 23 6 THR A 85 ? ? -82.12 42.62 24 6 THR A 86 ? ? -173.36 149.36 25 6 ASP A 114 ? ? -58.35 89.72 26 6 SER A 127 ? ? -112.77 -164.82 27 6 HIS A 158 ? ? 78.06 -56.65 28 8 SER A 2 ? ? -178.42 141.10 29 8 GLU A 59 ? ? -139.40 -35.54 30 8 ASP A 79 ? ? -80.54 41.08 31 8 THR A 85 ? ? -95.00 54.02 32 8 SER A 154 ? ? -85.15 33.10 33 8 HIS A 160 ? ? -68.75 86.60 34 9 ASP A 79 ? ? -77.92 29.87 35 9 LEU A 155 ? ? -90.95 32.07 36 10 SER A 2 ? ? -69.54 87.56 37 10 ASP A 79 ? ? -78.06 27.77 38 10 ASP A 128 ? ? -54.67 101.96 39 11 ASP A 79 ? ? -74.53 25.99 40 11 HIS A 158 ? ? -133.68 -39.19 41 11 HIS A 159 ? ? -75.61 39.74 42 12 SER A 2 ? ? -69.99 88.85 43 12 GLU A 59 ? ? -147.74 -40.94 44 12 TYR A 75 ? ? -119.85 78.71 45 12 ASP A 79 ? ? -77.64 40.60 46 12 SER A 127 ? ? -162.32 -169.01 47 12 SER A 154 ? ? -163.81 104.21 48 12 GLU A 156 ? ? -68.55 83.71 49 12 HIS A 157 ? ? -96.76 54.07 50 12 HIS A 161 ? ? 74.01 -28.93 51 13 ASP A 79 ? ? -78.69 24.53 52 14 GLU A 59 ? ? -157.02 -30.16 53 14 LEU A 78 ? ? 59.28 19.37 54 14 ASP A 79 ? ? -75.92 37.01 55 14 THR A 86 ? ? 179.34 161.56 56 14 SER A 154 ? ? -76.22 49.07 57 14 LEU A 155 ? ? -136.76 -149.84 58 14 HIS A 157 ? ? 34.70 75.15 59 14 HIS A 158 ? ? -92.38 34.36 60 14 HIS A 160 ? ? -158.09 74.00 61 14 HIS A 161 ? ? -168.25 99.84 62 15 GLU A 59 ? ? -147.51 -42.94 63 15 LEU A 78 ? ? 70.16 34.97 64 15 ASP A 79 ? ? -77.46 34.93 65 15 LYS A 113 ? ? -79.05 31.79 66 15 HIS A 160 ? ? -164.60 -69.67 67 15 HIS A 161 ? ? -170.08 -46.85 68 16 ASP A 79 ? ? -77.35 32.99 69 16 THR A 85 ? ? -84.02 48.23 70 16 ASP A 114 ? ? -66.06 98.85 71 16 ARG A 126 ? ? -69.91 91.61 72 17 ASP A 79 ? ? -79.65 37.87 73 18 ASP A 79 ? ? -78.12 35.08 74 18 ASP A 88 ? ? -59.51 109.75 75 18 LYS A 113 ? ? -74.86 -75.66 76 19 ASP A 79 ? ? -75.71 29.68 77 19 THR A 85 ? ? -82.49 34.54 78 19 ARG A 126 ? ? -67.00 82.97 79 19 ASP A 128 ? ? 53.88 -84.46 80 19 GLU A 156 ? ? -104.43 -70.92 81 19 HIS A 157 ? ? -127.49 -169.11 82 20 ASP A 79 ? ? -73.73 27.83 83 20 ASP A 114 ? ? -58.45 98.56 #