data_2L8E # _entry.id 2L8E # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2L8E pdb_00002l8e 10.2210/pdb2l8e/pdb RCSB RCSB102085 ? ? BMRB 17396 ? 10.13018/BMR17396 WWPDB D_1000102085 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-12-21 2 'Structure model' 1 1 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_nmr_software 5 2 'Structure model' pdbx_nmr_spectrometer 6 2 'Structure model' pdbx_struct_conn_angle 7 2 'Structure model' struct_conn 8 2 'Structure model' struct_ref_seq_dif 9 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_nmr_software.name' 4 2 'Structure model' '_pdbx_nmr_spectrometer.model' 5 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 7 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 8 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 9 2 'Structure model' '_pdbx_struct_conn_angle.value' 10 2 'Structure model' '_struct_conn.pdbx_dist_value' 11 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 12 2 'Structure model' '_struct_conn.ptnr1_label_seq_id' 13 2 'Structure model' '_struct_ref_seq_dif.details' 14 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 15 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 16 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2L8E _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-01-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 17396 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ilangovan, U.' 1 'Kim, C.' 2 # _citation.id primary _citation.title '1H, 15N and 13C assigned chemical shifts of FCS domain from human polyhomeotic homolog 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, R.' 1 ? primary 'Ilangovan, U.' 2 ? primary 'Kim, C.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Polyhomeotic-like protein 1' 5490.305 1 ? ? 'FCS-type zinc finger domain residues 783-828' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hPH1, Early development regulatory protein 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GTRGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN _entity_poly.pdbx_seq_one_letter_code_can GTRGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 THR n 1 3 ARG n 1 4 GLY n 1 5 VAL n 1 6 ASP n 1 7 SER n 1 8 PRO n 1 9 SER n 1 10 ALA n 1 11 GLU n 1 12 LEU n 1 13 ASP n 1 14 LYS n 1 15 LYS n 1 16 ALA n 1 17 ASN n 1 18 LEU n 1 19 LEU n 1 20 LYS n 1 21 CYS n 1 22 GLU n 1 23 TYR n 1 24 CYS n 1 25 GLY n 1 26 LYS n 1 27 TYR n 1 28 ALA n 1 29 PRO n 1 30 ALA n 1 31 GLU n 1 32 GLN n 1 33 PHE n 1 34 ARG n 1 35 GLY n 1 36 SER n 1 37 LYS n 1 38 ARG n 1 39 PHE n 1 40 CYS n 1 41 SER n 1 42 MET n 1 43 THR n 1 44 CYS n 1 45 ALA n 1 46 LYS n 1 47 ARG n 1 48 TYR n 1 49 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PHC1, EDR1, PH1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLY 4 783 783 GLY GLY A . n A 1 5 VAL 5 784 784 VAL VAL A . n A 1 6 ASP 6 785 785 ASP ASP A . n A 1 7 SER 7 786 786 SER SER A . n A 1 8 PRO 8 787 787 PRO PRO A . n A 1 9 SER 9 788 788 SER SER A . n A 1 10 ALA 10 789 789 ALA ALA A . n A 1 11 GLU 11 790 790 GLU GLU A . n A 1 12 LEU 12 791 791 LEU LEU A . n A 1 13 ASP 13 792 792 ASP ASP A . n A 1 14 LYS 14 793 793 LYS LYS A . n A 1 15 LYS 15 794 794 LYS LYS A . n A 1 16 ALA 16 795 795 ALA ALA A . n A 1 17 ASN 17 796 796 ASN ASN A . n A 1 18 LEU 18 797 797 LEU LEU A . n A 1 19 LEU 19 798 798 LEU LEU A . n A 1 20 LYS 20 799 799 LYS LYS A . n A 1 21 CYS 21 800 800 CYS CYS A . n A 1 22 GLU 22 801 801 GLU GLU A . n A 1 23 TYR 23 802 802 TYR TYR A . n A 1 24 CYS 24 803 803 CYS CYS A . n A 1 25 GLY 25 804 804 GLY GLY A . n A 1 26 LYS 26 805 805 LYS LYS A . n A 1 27 TYR 27 806 806 TYR TYR A . n A 1 28 ALA 28 807 807 ALA ALA A . n A 1 29 PRO 29 808 808 PRO PRO A . n A 1 30 ALA 30 809 809 ALA ALA A . n A 1 31 GLU 31 810 810 GLU GLU A . n A 1 32 GLN 32 811 811 GLN GLN A . n A 1 33 PHE 33 812 812 PHE PHE A . n A 1 34 ARG 34 813 813 ARG ARG A . n A 1 35 GLY 35 814 814 GLY GLY A . n A 1 36 SER 36 815 815 SER SER A . n A 1 37 LYS 37 816 816 LYS LYS A . n A 1 38 ARG 38 817 817 ARG ARG A . n A 1 39 PHE 39 818 818 PHE PHE A . n A 1 40 CYS 40 819 819 CYS CYS A . n A 1 41 SER 41 820 820 SER SER A . n A 1 42 MET 42 821 821 MET MET A . n A 1 43 THR 43 822 822 THR THR A . n A 1 44 CYS 44 823 823 CYS CYS A . n A 1 45 ALA 45 824 824 ALA ALA A . n A 1 46 LYS 46 825 825 LYS LYS A . n A 1 47 ARG 47 826 826 ARG ARG A . n A 1 48 TYR 48 827 827 TYR TYR A . n A 1 49 ASN 49 828 828 ASN ASN A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 829 _pdbx_nonpoly_scheme.auth_seq_num 800 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2L8E _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2L8E _struct.title 'Solution NMR structure of FCS domain of Human Polyhomeotic Homolog 1 (HPH1)' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2L8E _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' _struct_keywords.text 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHC1_HUMAN _struct_ref.pdbx_db_accession P78364 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYN _struct_ref.pdbx_align_begin 783 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2L8E _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 49 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78364 _struct_ref_seq.db_align_beg 783 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 828 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 783 _struct_ref_seq.pdbx_auth_seq_align_end 828 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2L8E GLY A 1 ? UNP P78364 ? ? 'expression tag' 1 1 1 2L8E THR A 2 ? UNP P78364 ? ? 'expression tag' 2 2 1 2L8E ARG A 3 ? UNP P78364 ? ? 'expression tag' 3 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 9 ? ALA A 16 ? SER A 788 ALA A 795 5 ? 8 HELX_P HELX_P2 2 GLU A 31 ? PHE A 33 ? GLU A 810 PHE A 812 5 ? 3 HELX_P HELX_P3 3 SER A 41 ? ASN A 49 ? SER A 820 ASN A 828 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 800 A ZN 829 1_555 ? ? ? ? ? ? ? 2.317 ? ? metalc2 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 803 A ZN 829 1_555 ? ? ? ? ? ? ? 2.211 ? ? metalc3 metalc ? ? A CYS 40 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 819 A ZN 829 1_555 ? ? ? ? ? ? ? 2.211 ? ? metalc4 metalc ? ? A CYS 44 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 823 A ZN 829 1_555 ? ? ? ? ? ? ? 2.152 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 21 ? A CYS 800 ? 1_555 ZN ? B ZN . ? A ZN 829 ? 1_555 SG ? A CYS 24 ? A CYS 803 ? 1_555 94.1 ? 2 SG ? A CYS 21 ? A CYS 800 ? 1_555 ZN ? B ZN . ? A ZN 829 ? 1_555 SG ? A CYS 40 ? A CYS 819 ? 1_555 90.2 ? 3 SG ? A CYS 24 ? A CYS 803 ? 1_555 ZN ? B ZN . ? A ZN 829 ? 1_555 SG ? A CYS 40 ? A CYS 819 ? 1_555 127.5 ? 4 SG ? A CYS 21 ? A CYS 800 ? 1_555 ZN ? B ZN . ? A ZN 829 ? 1_555 SG ? A CYS 44 ? A CYS 823 ? 1_555 124.6 ? 5 SG ? A CYS 24 ? A CYS 803 ? 1_555 ZN ? B ZN . ? A ZN 829 ? 1_555 SG ? A CYS 44 ? A CYS 823 ? 1_555 116.0 ? 6 SG ? A CYS 40 ? A CYS 819 ? 1_555 ZN ? B ZN . ? A ZN 829 ? 1_555 SG ? A CYS 44 ? A CYS 823 ? 1_555 103.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 18 ? LYS A 20 ? LEU A 797 LYS A 799 A 2 TYR A 27 ? PRO A 29 ? TYR A 806 PRO A 808 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 19 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 798 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ALA _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 28 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 807 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 829 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 829' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 21 ? CYS A 800 . ? 1_555 ? 2 AC1 4 CYS A 24 ? CYS A 803 . ? 1_555 ? 3 AC1 4 CYS A 40 ? CYS A 819 . ? 1_555 ? 4 AC1 4 CYS A 44 ? CYS A 823 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A CYS 819 ? ? HG A SER 820 ? ? 1.57 2 6 HG A SER 786 ? ? OD1 A ASP 792 ? ? 1.55 3 8 HG A SER 786 ? ? OE1 A GLU 790 ? ? 1.56 4 10 O A CYS 819 ? ? HG A SER 820 ? ? 1.56 5 11 HA A GLU 790 ? ? HB3 A LYS 793 ? ? 1.31 6 16 O A CYS 819 ? ? HG A SER 820 ? ? 1.58 7 18 O A CYS 819 ? ? HG A SER 820 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 2 ? ? -93.92 34.68 2 1 ASP A 785 ? ? -89.28 44.07 3 1 LYS A 793 ? ? 73.92 -23.66 4 1 GLU A 801 ? ? -62.92 12.88 5 1 TYR A 802 ? ? -105.81 -89.63 6 1 ARG A 817 ? ? -144.30 -42.56 7 1 CYS A 819 ? ? -68.57 -157.79 8 1 SER A 820 ? ? -67.87 -131.04 9 2 LEU A 791 ? ? -78.22 41.09 10 2 ASP A 792 ? ? 177.95 -33.02 11 2 LYS A 794 ? ? -162.69 -76.88 12 2 GLU A 801 ? ? -59.26 -3.48 13 2 PHE A 812 ? ? -69.84 54.99 14 2 ARG A 817 ? ? -153.91 -31.34 15 2 SER A 820 ? ? 82.75 -154.38 16 3 THR A 2 ? ? 74.98 -48.22 17 3 ARG A 3 ? ? -87.27 -74.28 18 3 VAL A 784 ? ? 77.33 -56.97 19 3 ALA A 795 ? ? -161.17 33.14 20 3 CYS A 800 ? ? -44.75 108.09 21 3 GLU A 801 ? ? -65.01 16.20 22 3 PHE A 812 ? ? -70.29 45.13 23 3 SER A 815 ? ? -171.03 124.98 24 3 ARG A 817 ? ? -140.10 -30.66 25 3 CYS A 819 ? ? -68.37 -157.41 26 3 SER A 820 ? ? -67.49 -137.10 27 4 ALA A 789 ? ? -72.69 -78.24 28 4 ASN A 796 ? ? -161.79 24.45 29 4 CYS A 800 ? ? -52.19 102.60 30 4 GLU A 801 ? ? -67.67 19.13 31 4 PHE A 812 ? ? -69.33 62.96 32 4 SER A 815 ? ? 73.22 142.45 33 4 ARG A 817 ? ? -145.79 -32.22 34 4 SER A 820 ? ? 87.10 -147.86 35 5 ARG A 3 ? ? -151.32 27.19 36 5 PRO A 787 ? ? -68.03 35.82 37 5 SER A 788 ? ? -105.70 -159.18 38 5 ALA A 795 ? ? 66.43 -3.84 39 5 PHE A 812 ? ? -68.93 57.23 40 5 ARG A 817 ? ? -143.53 -42.25 41 5 CYS A 819 ? ? -67.88 -158.62 42 5 SER A 820 ? ? -67.84 -151.81 43 6 ASP A 785 ? ? 66.20 113.81 44 6 ASP A 792 ? ? -67.84 93.07 45 6 LYS A 793 ? ? 69.22 -4.85 46 6 LYS A 794 ? ? 75.71 115.70 47 6 ALA A 795 ? ? -167.04 56.73 48 6 ASN A 796 ? ? -158.19 59.53 49 6 CYS A 800 ? ? -46.02 103.05 50 6 GLU A 801 ? ? -69.72 21.16 51 6 SER A 815 ? ? 76.49 141.90 52 6 SER A 820 ? ? 82.50 -165.04 53 7 ARG A 3 ? ? -111.48 78.89 54 7 ASP A 785 ? ? 61.26 79.24 55 7 LYS A 793 ? ? -160.84 -48.91 56 7 LYS A 794 ? ? -90.41 34.76 57 7 ALA A 795 ? ? -73.29 -87.20 58 7 ASN A 796 ? ? 33.90 54.20 59 7 GLU A 801 ? ? -61.11 0.14 60 7 SER A 815 ? ? -175.49 137.04 61 7 ARG A 817 ? ? -147.52 -30.34 62 7 CYS A 819 ? ? -68.70 -159.23 63 7 SER A 820 ? ? -62.64 -123.10 64 8 ASP A 785 ? ? -151.22 72.94 65 8 ALA A 795 ? ? -159.08 30.03 66 8 CYS A 800 ? ? -51.64 100.83 67 8 GLU A 801 ? ? -65.43 23.79 68 8 TYR A 802 ? ? -108.86 -85.11 69 8 PHE A 812 ? ? -96.59 48.08 70 8 SER A 815 ? ? 71.14 141.71 71 8 ARG A 817 ? ? -140.86 -36.41 72 8 CYS A 819 ? ? -68.28 -161.17 73 8 SER A 820 ? ? -67.80 -116.67 74 9 LEU A 791 ? ? -93.40 57.95 75 9 LYS A 793 ? ? 70.74 -71.21 76 9 LYS A 794 ? ? 67.61 -73.28 77 9 GLU A 801 ? ? -68.02 21.45 78 9 PHE A 812 ? ? -96.03 49.35 79 9 CYS A 819 ? ? -68.24 -157.95 80 9 SER A 820 ? ? -68.65 -125.86 81 10 PRO A 787 ? ? -72.27 26.18 82 10 LYS A 793 ? ? 75.26 -69.32 83 10 ALA A 795 ? ? 51.57 -94.77 84 10 CYS A 800 ? ? -43.44 106.21 85 10 GLU A 801 ? ? -66.46 13.31 86 10 PHE A 812 ? ? -69.00 62.50 87 10 ARG A 817 ? ? -142.94 -32.43 88 10 SER A 820 ? ? 84.92 -154.63 89 11 VAL A 784 ? ? -114.81 -168.92 90 11 ASP A 792 ? ? -147.61 10.96 91 11 ALA A 795 ? ? -168.18 31.99 92 11 CYS A 800 ? ? -36.57 111.99 93 11 GLU A 801 ? ? -56.36 -6.45 94 11 ARG A 817 ? ? -140.02 -34.67 95 11 SER A 820 ? ? 87.41 -154.90 96 12 VAL A 784 ? ? -87.95 46.84 97 12 LYS A 794 ? ? -75.63 -71.32 98 12 CYS A 800 ? ? -47.14 103.82 99 12 GLU A 801 ? ? -67.40 19.92 100 12 PHE A 812 ? ? -68.89 63.43 101 12 ARG A 817 ? ? -145.07 -34.80 102 12 CYS A 819 ? ? -68.57 -159.48 103 12 SER A 820 ? ? -64.66 -116.94 104 13 THR A 2 ? ? -113.32 75.01 105 13 LYS A 793 ? ? -164.47 -43.90 106 13 LYS A 794 ? ? -81.49 -78.65 107 13 ALA A 795 ? ? 27.13 67.57 108 13 CYS A 800 ? ? -45.39 104.69 109 13 GLU A 801 ? ? -64.29 12.38 110 13 PHE A 812 ? ? -70.72 32.57 111 13 SER A 815 ? ? -145.03 -44.65 112 13 ARG A 817 ? ? -155.13 -37.19 113 13 CYS A 819 ? ? -68.87 -158.20 114 13 SER A 820 ? ? -69.79 -134.71 115 14 VAL A 784 ? ? -100.41 -72.38 116 14 PRO A 787 ? ? -68.31 0.81 117 14 LYS A 793 ? ? -159.26 -38.15 118 14 ALA A 795 ? ? -169.71 -39.29 119 14 GLU A 801 ? ? -61.82 3.76 120 14 ARG A 817 ? ? -144.01 -28.77 121 14 SER A 820 ? ? 89.83 -163.89 122 15 THR A 2 ? ? 74.76 -52.60 123 15 ASP A 792 ? ? -59.25 99.57 124 15 LYS A 793 ? ? 71.93 -66.25 125 15 ALA A 795 ? ? -164.20 30.10 126 15 CYS A 800 ? ? -40.60 107.43 127 15 GLU A 801 ? ? -61.33 0.53 128 15 PHE A 812 ? ? -96.13 53.98 129 15 ARG A 817 ? ? -142.28 -33.56 130 15 SER A 820 ? ? 88.11 -155.26 131 16 ARG A 3 ? ? 69.10 -68.51 132 16 LYS A 794 ? ? -163.31 -153.97 133 16 ALA A 795 ? ? 79.58 -9.37 134 16 CYS A 800 ? ? -39.07 109.45 135 16 GLU A 801 ? ? -62.62 6.00 136 16 SER A 815 ? ? 70.42 143.86 137 16 ARG A 817 ? ? -143.76 -29.94 138 16 CYS A 819 ? ? -50.20 107.75 139 16 SER A 820 ? ? 89.07 -161.07 140 17 SER A 788 ? ? -89.34 -109.20 141 17 LEU A 791 ? ? -16.21 67.04 142 17 LYS A 793 ? ? 78.15 -61.20 143 17 LYS A 794 ? ? 71.74 -39.31 144 17 CYS A 800 ? ? -46.83 103.87 145 17 GLU A 801 ? ? -65.58 18.12 146 17 ARG A 817 ? ? -151.26 -32.16 147 17 CYS A 819 ? ? -66.22 -161.04 148 17 SER A 820 ? ? -69.38 -119.42 149 18 ALA A 789 ? ? -83.97 47.51 150 18 LYS A 794 ? ? -161.08 -131.03 151 18 CYS A 800 ? ? -41.85 104.21 152 18 GLU A 801 ? ? -61.91 7.52 153 18 SER A 815 ? ? 73.99 138.09 154 18 ARG A 817 ? ? -147.71 -29.47 155 18 SER A 820 ? ? 87.51 -154.74 156 19 GLU A 801 ? ? -62.31 13.90 157 19 TYR A 802 ? ? -108.43 -88.72 158 19 PHE A 812 ? ? -68.64 58.54 159 19 ARG A 817 ? ? -136.23 -34.85 160 19 CYS A 819 ? ? -67.21 -158.82 161 19 SER A 820 ? ? -67.26 -120.49 162 20 THR A 2 ? ? 62.42 91.62 163 20 ALA A 789 ? ? -61.69 -72.05 164 20 LYS A 793 ? ? -165.80 -39.92 165 20 LYS A 794 ? ? 64.17 91.41 166 20 ALA A 795 ? ? -163.59 51.44 167 20 ASN A 796 ? ? -149.17 56.75 168 20 CYS A 800 ? ? -43.12 107.38 169 20 GLU A 801 ? ? -62.82 5.69 170 20 PHE A 812 ? ? -69.81 49.84 171 20 ARG A 817 ? ? -148.03 -34.37 172 20 SER A 820 ? ? 88.36 -158.21 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2L8E _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2L8E _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.5 mM [U-100% 15N] Zn bound FCS domain of hPh1, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1.5 mM [U-95% 13C; U-95% 15N] Zn bound FCS domain of hPh1, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '1.5 mM [U-10% 13C; U-99% 15N] Zn bound FCS domain of hPh1, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Zn bound FCS domain of hPh1-1' 1.5 ? mM '[U-100% 15N]' 1 'Zn bound FCS domain of hPh1-2' 1.5 ? mM '[U-95% 13C; U-95% 15N]' 2 'Zn bound FCS domain of hPh1-3' 1.5 ? mM '[U-10% 13C; U-99% 15N]' 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.050 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNHA' 1 3 1 '3D 1H-15N NOESY' 1 4 1 '3D 1H-15N TOCSY' 1 5 2 '2D 1H-13C HSQC' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D HNCACB' 1 8 2 '3D C(CO)NH' 1 9 2 '3D HCCH-TOCSY' 1 10 3 ct-hsqc 1 11 3 hbcbcgcdhdgp 1 12 3 hbcbcgcdcehegp # _pdbx_nmr_refine.entry_id 2L8E _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 2 'Bruker Biospin' collection TopSpin ? 3 ? refinement ARIA ? 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 LEU N N N N 137 LEU CA C N S 138 LEU C C N N 139 LEU O O N N 140 LEU CB C N N 141 LEU CG C N N 142 LEU CD1 C N N 143 LEU CD2 C N N 144 LEU OXT O N N 145 LEU H H N N 146 LEU H2 H N N 147 LEU HA H N N 148 LEU HB2 H N N 149 LEU HB3 H N N 150 LEU HG H N N 151 LEU HD11 H N N 152 LEU HD12 H N N 153 LEU HD13 H N N 154 LEU HD21 H N N 155 LEU HD22 H N N 156 LEU HD23 H N N 157 LEU HXT H N N 158 LYS N N N N 159 LYS CA C N S 160 LYS C C N N 161 LYS O O N N 162 LYS CB C N N 163 LYS CG C N N 164 LYS CD C N N 165 LYS CE C N N 166 LYS NZ N N N 167 LYS OXT O N N 168 LYS H H N N 169 LYS H2 H N N 170 LYS HA H N N 171 LYS HB2 H N N 172 LYS HB3 H N N 173 LYS HG2 H N N 174 LYS HG3 H N N 175 LYS HD2 H N N 176 LYS HD3 H N N 177 LYS HE2 H N N 178 LYS HE3 H N N 179 LYS HZ1 H N N 180 LYS HZ2 H N N 181 LYS HZ3 H N N 182 LYS HXT H N N 183 MET N N N N 184 MET CA C N S 185 MET C C N N 186 MET O O N N 187 MET CB C N N 188 MET CG C N N 189 MET SD S N N 190 MET CE C N N 191 MET OXT O N N 192 MET H H N N 193 MET H2 H N N 194 MET HA H N N 195 MET HB2 H N N 196 MET HB3 H N N 197 MET HG2 H N N 198 MET HG3 H N N 199 MET HE1 H N N 200 MET HE2 H N N 201 MET HE3 H N N 202 MET HXT H N N 203 PHE N N N N 204 PHE CA C N S 205 PHE C C N N 206 PHE O O N N 207 PHE CB C N N 208 PHE CG C Y N 209 PHE CD1 C Y N 210 PHE CD2 C Y N 211 PHE CE1 C Y N 212 PHE CE2 C Y N 213 PHE CZ C Y N 214 PHE OXT O N N 215 PHE H H N N 216 PHE H2 H N N 217 PHE HA H N N 218 PHE HB2 H N N 219 PHE HB3 H N N 220 PHE HD1 H N N 221 PHE HD2 H N N 222 PHE HE1 H N N 223 PHE HE2 H N N 224 PHE HZ H N N 225 PHE HXT H N N 226 PRO N N N N 227 PRO CA C N S 228 PRO C C N N 229 PRO O O N N 230 PRO CB C N N 231 PRO CG C N N 232 PRO CD C N N 233 PRO OXT O N N 234 PRO H H N N 235 PRO HA H N N 236 PRO HB2 H N N 237 PRO HB3 H N N 238 PRO HG2 H N N 239 PRO HG3 H N N 240 PRO HD2 H N N 241 PRO HD3 H N N 242 PRO HXT H N N 243 SER N N N N 244 SER CA C N S 245 SER C C N N 246 SER O O N N 247 SER CB C N N 248 SER OG O N N 249 SER OXT O N N 250 SER H H N N 251 SER H2 H N N 252 SER HA H N N 253 SER HB2 H N N 254 SER HB3 H N N 255 SER HG H N N 256 SER HXT H N N 257 THR N N N N 258 THR CA C N S 259 THR C C N N 260 THR O O N N 261 THR CB C N R 262 THR OG1 O N N 263 THR CG2 C N N 264 THR OXT O N N 265 THR H H N N 266 THR H2 H N N 267 THR HA H N N 268 THR HB H N N 269 THR HG1 H N N 270 THR HG21 H N N 271 THR HG22 H N N 272 THR HG23 H N N 273 THR HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 ZN ZN ZN N N 318 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 LEU N CA sing N N 129 LEU N H sing N N 130 LEU N H2 sing N N 131 LEU CA C sing N N 132 LEU CA CB sing N N 133 LEU CA HA sing N N 134 LEU C O doub N N 135 LEU C OXT sing N N 136 LEU CB CG sing N N 137 LEU CB HB2 sing N N 138 LEU CB HB3 sing N N 139 LEU CG CD1 sing N N 140 LEU CG CD2 sing N N 141 LEU CG HG sing N N 142 LEU CD1 HD11 sing N N 143 LEU CD1 HD12 sing N N 144 LEU CD1 HD13 sing N N 145 LEU CD2 HD21 sing N N 146 LEU CD2 HD22 sing N N 147 LEU CD2 HD23 sing N N 148 LEU OXT HXT sing N N 149 LYS N CA sing N N 150 LYS N H sing N N 151 LYS N H2 sing N N 152 LYS CA C sing N N 153 LYS CA CB sing N N 154 LYS CA HA sing N N 155 LYS C O doub N N 156 LYS C OXT sing N N 157 LYS CB CG sing N N 158 LYS CB HB2 sing N N 159 LYS CB HB3 sing N N 160 LYS CG CD sing N N 161 LYS CG HG2 sing N N 162 LYS CG HG3 sing N N 163 LYS CD CE sing N N 164 LYS CD HD2 sing N N 165 LYS CD HD3 sing N N 166 LYS CE NZ sing N N 167 LYS CE HE2 sing N N 168 LYS CE HE3 sing N N 169 LYS NZ HZ1 sing N N 170 LYS NZ HZ2 sing N N 171 LYS NZ HZ3 sing N N 172 LYS OXT HXT sing N N 173 MET N CA sing N N 174 MET N H sing N N 175 MET N H2 sing N N 176 MET CA C sing N N 177 MET CA CB sing N N 178 MET CA HA sing N N 179 MET C O doub N N 180 MET C OXT sing N N 181 MET CB CG sing N N 182 MET CB HB2 sing N N 183 MET CB HB3 sing N N 184 MET CG SD sing N N 185 MET CG HG2 sing N N 186 MET CG HG3 sing N N 187 MET SD CE sing N N 188 MET CE HE1 sing N N 189 MET CE HE2 sing N N 190 MET CE HE3 sing N N 191 MET OXT HXT sing N N 192 PHE N CA sing N N 193 PHE N H sing N N 194 PHE N H2 sing N N 195 PHE CA C sing N N 196 PHE CA CB sing N N 197 PHE CA HA sing N N 198 PHE C O doub N N 199 PHE C OXT sing N N 200 PHE CB CG sing N N 201 PHE CB HB2 sing N N 202 PHE CB HB3 sing N N 203 PHE CG CD1 doub Y N 204 PHE CG CD2 sing Y N 205 PHE CD1 CE1 sing Y N 206 PHE CD1 HD1 sing N N 207 PHE CD2 CE2 doub Y N 208 PHE CD2 HD2 sing N N 209 PHE CE1 CZ doub Y N 210 PHE CE1 HE1 sing N N 211 PHE CE2 CZ sing Y N 212 PHE CE2 HE2 sing N N 213 PHE CZ HZ sing N N 214 PHE OXT HXT sing N N 215 PRO N CA sing N N 216 PRO N CD sing N N 217 PRO N H sing N N 218 PRO CA C sing N N 219 PRO CA CB sing N N 220 PRO CA HA sing N N 221 PRO C O doub N N 222 PRO C OXT sing N N 223 PRO CB CG sing N N 224 PRO CB HB2 sing N N 225 PRO CB HB3 sing N N 226 PRO CG CD sing N N 227 PRO CG HG2 sing N N 228 PRO CG HG3 sing N N 229 PRO CD HD2 sing N N 230 PRO CD HD3 sing N N 231 PRO OXT HXT sing N N 232 SER N CA sing N N 233 SER N H sing N N 234 SER N H2 sing N N 235 SER CA C sing N N 236 SER CA CB sing N N 237 SER CA HA sing N N 238 SER C O doub N N 239 SER C OXT sing N N 240 SER CB OG sing N N 241 SER CB HB2 sing N N 242 SER CB HB3 sing N N 243 SER OG HG sing N N 244 SER OXT HXT sing N N 245 THR N CA sing N N 246 THR N H sing N N 247 THR N H2 sing N N 248 THR CA C sing N N 249 THR CA CB sing N N 250 THR CA HA sing N N 251 THR C O doub N N 252 THR C OXT sing N N 253 THR CB OG1 sing N N 254 THR CB CG2 sing N N 255 THR CB HB sing N N 256 THR OG1 HG1 sing N N 257 THR CG2 HG21 sing N N 258 THR CG2 HG22 sing N N 259 THR CG2 HG23 sing N N 260 THR OXT HXT sing N N 261 TYR N CA sing N N 262 TYR N H sing N N 263 TYR N H2 sing N N 264 TYR CA C sing N N 265 TYR CA CB sing N N 266 TYR CA HA sing N N 267 TYR C O doub N N 268 TYR C OXT sing N N 269 TYR CB CG sing N N 270 TYR CB HB2 sing N N 271 TYR CB HB3 sing N N 272 TYR CG CD1 doub Y N 273 TYR CG CD2 sing Y N 274 TYR CD1 CE1 sing Y N 275 TYR CD1 HD1 sing N N 276 TYR CD2 CE2 doub Y N 277 TYR CD2 HD2 sing N N 278 TYR CE1 CZ doub Y N 279 TYR CE1 HE1 sing N N 280 TYR CE2 CZ sing Y N 281 TYR CE2 HE2 sing N N 282 TYR CZ OH sing N N 283 TYR OH HH sing N N 284 TYR OXT HXT sing N N 285 VAL N CA sing N N 286 VAL N H sing N N 287 VAL N H2 sing N N 288 VAL CA C sing N N 289 VAL CA CB sing N N 290 VAL CA HA sing N N 291 VAL C O doub N N 292 VAL C OXT sing N N 293 VAL CB CG1 sing N N 294 VAL CB CG2 sing N N 295 VAL CB HB sing N N 296 VAL CG1 HG11 sing N N 297 VAL CG1 HG12 sing N N 298 VAL CG1 HG13 sing N N 299 VAL CG2 HG21 sing N N 300 VAL CG2 HG22 sing N N 301 VAL CG2 HG23 sing N N 302 VAL OXT HXT sing N N 303 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2L8E _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_