data_2LAH # _entry.id 2LAH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LAH pdb_00002lah 10.2210/pdb2lah/pdb RCSB RCSB102159 ? ? BMRB 17524 ? ? WWPDB D_1000102159 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17524 BMRB unspecified . HR5460A TargetDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LAH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, G.' 1 'Xiao, R.' 2 'Lee, H.' 3 'Hamilton, K.' 4 'Acton, T.B.' 5 'Ciccosanti, C.' 6 'Everett, J.K.' 7 'Shastry, R.T.' 8 'Huang, Y.J.' 9 'Montelione, G.T.' 10 'Northeast Structural Genomics Consortium, n.' 11 'Northeast Structural Genomics Consortium (NESG)' 12 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target HR5460A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, G.' 1 ? primary 'Shastry, R.' 2 ? primary 'Ciccosanti, C.' 3 ? primary 'Hamilton, K.' 4 ? primary 'Acton, T.B.' 5 ? primary 'Xiao, R.' 6 ? primary 'Everett, J.K.' 7 ? primary 'Montelione, G.T.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Mitotic checkpoint serine/threonine-protein kinase BUB1' _entity.formula_weight 19209.490 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.11.1 _entity.pdbx_mutation ? _entity.pdbx_fragment 'N-terminal domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hBUB1, BUB1A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFIS YCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET ; _entity_poly.pdbx_seq_one_letter_code_can ;MGHHHHHHSHMDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFIS YCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HR5460A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 HIS n 1 11 MET n 1 12 ASP n 1 13 THR n 1 14 PRO n 1 15 GLU n 1 16 ASN n 1 17 VAL n 1 18 LEU n 1 19 GLN n 1 20 MET n 1 21 LEU n 1 22 GLU n 1 23 ALA n 1 24 HIS n 1 25 MET n 1 26 GLN n 1 27 SER n 1 28 TYR n 1 29 LYS n 1 30 GLY n 1 31 ASN n 1 32 ASP n 1 33 PRO n 1 34 LEU n 1 35 GLY n 1 36 GLU n 1 37 TRP n 1 38 GLU n 1 39 ARG n 1 40 TYR n 1 41 ILE n 1 42 GLN n 1 43 TRP n 1 44 VAL n 1 45 GLU n 1 46 GLU n 1 47 ASN n 1 48 PHE n 1 49 PRO n 1 50 GLU n 1 51 ASN n 1 52 LYS n 1 53 GLU n 1 54 TYR n 1 55 LEU n 1 56 ILE n 1 57 THR n 1 58 LEU n 1 59 LEU n 1 60 GLU n 1 61 HIS n 1 62 LEU n 1 63 MET n 1 64 LYS n 1 65 GLU n 1 66 PHE n 1 67 LEU n 1 68 ASP n 1 69 LYS n 1 70 LYS n 1 71 LYS n 1 72 TYR n 1 73 HIS n 1 74 ASN n 1 75 ASP n 1 76 PRO n 1 77 ARG n 1 78 PHE n 1 79 ILE n 1 80 SER n 1 81 TYR n 1 82 CYS n 1 83 LEU n 1 84 LYS n 1 85 PHE n 1 86 ALA n 1 87 GLU n 1 88 TYR n 1 89 ASN n 1 90 SER n 1 91 ASP n 1 92 LEU n 1 93 HIS n 1 94 GLN n 1 95 PHE n 1 96 PHE n 1 97 GLU n 1 98 PHE n 1 99 LEU n 1 100 TYR n 1 101 ASN n 1 102 HIS n 1 103 GLY n 1 104 ILE n 1 105 GLY n 1 106 THR n 1 107 LEU n 1 108 SER n 1 109 SER n 1 110 PRO n 1 111 LEU n 1 112 TYR n 1 113 ILE n 1 114 ALA n 1 115 TRP n 1 116 ALA n 1 117 GLY n 1 118 HIS n 1 119 LEU n 1 120 GLU n 1 121 ALA n 1 122 GLN n 1 123 GLY n 1 124 GLU n 1 125 LEU n 1 126 GLN n 1 127 HIS n 1 128 ALA n 1 129 SER n 1 130 ALA n 1 131 VAL n 1 132 LEU n 1 133 GLN n 1 134 ARG n 1 135 GLY n 1 136 ILE n 1 137 GLN n 1 138 ASN n 1 139 GLN n 1 140 ALA n 1 141 GLU n 1 142 PRO n 1 143 ARG n 1 144 GLU n 1 145 PHE n 1 146 LEU n 1 147 GLN n 1 148 GLN n 1 149 GLN n 1 150 TYR n 1 151 ARG n 1 152 LEU n 1 153 PHE n 1 154 GLN n 1 155 THR n 1 156 ARG n 1 157 LEU n 1 158 THR n 1 159 GLU n 1 160 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BUB1, BUB1L' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 14-15C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BUB1_HUMAN _struct_ref.pdbx_db_accession O43683 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNS DLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLTET ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LAH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 11 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 160 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43683 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 11 _struct_ref_seq.pdbx_auth_seq_align_end 160 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LAH MET A 1 ? UNP O43683 ? ? 'expression tag' 1 1 1 2LAH GLY A 2 ? UNP O43683 ? ? 'expression tag' 2 2 1 2LAH HIS A 3 ? UNP O43683 ? ? 'expression tag' 3 3 1 2LAH HIS A 4 ? UNP O43683 ? ? 'expression tag' 4 4 1 2LAH HIS A 5 ? UNP O43683 ? ? 'expression tag' 5 5 1 2LAH HIS A 6 ? UNP O43683 ? ? 'expression tag' 6 6 1 2LAH HIS A 7 ? UNP O43683 ? ? 'expression tag' 7 7 1 2LAH HIS A 8 ? UNP O43683 ? ? 'expression tag' 8 8 1 2LAH SER A 9 ? UNP O43683 ? ? 'expression tag' 9 9 1 2LAH HIS A 10 ? UNP O43683 ? ? 'expression tag' 10 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D 1H-13C arom NOESY' 1 7 1 '3D simutaneous 13C-aromatic,13C-aliphatic,15N edited 1H-1H NOESY' 1 8 2 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.164 mM [U-100% 13C; U-100% 15N] HR5460A, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '1.033 mM [U-10% 13C; U-100% 15N] HR5460A, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' 600 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LAH _pdbx_nmr_refine.method 'distance geometry, torsion angle dynamics, simulated annealing, molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LAH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LAH _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'refinemen,structure solution,geometry optimization' CNS ? 1 'Guntert, Mumenthaler and Wuthrich' 'refinement,geometry optimization,structure solution' CYANA 3.0 2 'Huang, Tejero, Powers and Montelione' 'data analysis,refinement' AutoStructure 2.1 3 'Zimmerman, Moseley, Kulikowski and Montelione' 'data analysis,chemical shift assignment' AutoAssign 2.1 4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 5 'Bartels et al.' 'data analysis,peak picking,chemical shift assignment' XEASY ? 6 'Bruker Biospin' collection TopSpin ? 7 Varian collection VnmrJ ? 8 Goddard 'data analysis' Sparky ? 9 'Shen, Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS+ ? 10 ? refinement CYANA ? 11 ? refinement CNS ? 12 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LAH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LAH _struct.title ;Solution NMR Structure of Mitotic checkpoint serine/threonine-protein kinase BUB1 N-terminal domain from Homo sapiens, Northeast Structural Genomics Consortium Target HR5460A (Methods Development) ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LAH _struct_keywords.pdbx_keywords 'CELL CYCLE, APOPTOSIS' _struct_keywords.text ;Structural Genomics, Protein NMR, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Target HR5460A, PSI-Biology, Protein Structure Initiative, CELL CYCLE, APOPTOSIS, Methods Development ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? SER A 27 ? THR A 13 SER A 27 1 ? 15 HELX_P HELX_P2 2 PRO A 33 ? PHE A 48 ? PRO A 33 PHE A 48 1 ? 16 HELX_P HELX_P3 3 ASN A 51 ? PHE A 66 ? ASN A 51 PHE A 66 1 ? 16 HELX_P HELX_P4 4 LYS A 69 ? HIS A 73 ? LYS A 69 HIS A 73 5 ? 5 HELX_P HELX_P5 5 ASP A 75 ? GLU A 87 ? ASP A 75 GLU A 87 1 ? 13 HELX_P HELX_P6 6 ASP A 91 ? HIS A 102 ? ASP A 91 HIS A 102 1 ? 12 HELX_P HELX_P7 7 SER A 108 ? GLY A 123 ? SER A 108 GLY A 123 1 ? 16 HELX_P HELX_P8 8 GLU A 124 ? GLN A 139 ? GLU A 124 GLN A 139 1 ? 16 HELX_P HELX_P9 9 PRO A 142 ? THR A 158 ? PRO A 142 THR A 158 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 1 -5.68 2 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 2 -7.46 3 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 3 -7.11 4 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 4 -10.10 5 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 5 -1.38 6 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 6 -7.94 7 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 7 -7.78 8 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 8 -7.04 9 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 9 -7.56 10 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 10 -6.66 11 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 11 -5.60 12 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 12 -4.66 13 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 13 -4.61 14 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 14 -4.00 15 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 15 -3.65 16 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 16 -1.43 17 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 17 -9.57 18 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 18 -3.19 19 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 19 -8.78 20 GLU 141 A . ? GLU 141 A PRO 142 A ? PRO 142 A 20 -6.94 # _atom_sites.entry_id 2LAH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 HIS 7 7 7 HIS HIS A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 MET 20 20 20 MET MET A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 HIS 24 24 24 HIS HIS A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 TYR 81 81 81 TYR TYR A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 HIS 93 93 93 HIS HIS A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 TRP 115 115 115 TRP TRP A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 GLN 148 148 148 GLN GLN A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 GLU 159 159 159 GLU GLU A . n A 1 160 THR 160 160 160 THR THR A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HR5460A-1 1.164 ? mM '[U-100% 13C; U-100% 15N]' 1 HR5460A-2 1.033 ? mM '[U-10% 13C; U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LAH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 4690 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 4 ? ? 68.44 -1.68 2 1 HIS A 6 ? ? -56.76 105.71 3 1 HIS A 8 ? ? -58.45 100.74 4 1 LYS A 29 ? ? -66.27 -71.88 5 1 ASP A 32 ? ? 66.77 101.72 6 2 HIS A 3 ? ? -144.42 40.94 7 2 HIS A 7 ? ? -67.54 89.92 8 2 TYR A 28 ? ? -66.12 97.54 9 2 LYS A 29 ? ? -114.71 77.06 10 2 GLU A 124 ? ? -93.91 50.19 11 3 HIS A 3 ? ? -66.14 87.11 12 3 HIS A 10 ? ? -95.38 -71.68 13 3 LYS A 69 ? ? -68.85 93.36 14 4 HIS A 5 ? ? 58.47 -72.66 15 4 SER A 9 ? ? -67.99 87.19 16 4 LYS A 29 ? ? 62.07 -85.68 17 4 ASP A 32 ? ? 58.50 80.13 18 5 HIS A 4 ? ? -68.82 99.83 19 5 MET A 11 ? ? -57.99 89.97 20 5 ASP A 32 ? ? 50.55 71.23 21 6 HIS A 3 ? ? -67.80 95.85 22 6 ASP A 32 ? ? -176.77 142.57 23 7 HIS A 8 ? ? -57.14 92.63 24 7 MET A 11 ? ? -163.53 99.79 25 8 SER A 9 ? ? -59.82 109.93 26 8 ASP A 12 ? ? -67.55 -173.18 27 8 LYS A 69 ? ? -66.27 88.71 28 8 ASP A 91 ? ? -99.76 43.11 29 8 GLU A 124 ? ? -87.31 46.84 30 9 LYS A 69 ? ? -69.00 90.61 31 10 HIS A 6 ? ? -69.67 96.31 32 10 SER A 9 ? ? -55.39 94.35 33 10 MET A 11 ? ? -148.13 54.91 34 10 ASP A 32 ? ? -147.54 50.16 35 10 ALA A 140 ? ? -59.55 100.91 36 11 HIS A 3 ? ? 54.74 84.28 37 11 HIS A 4 ? ? -134.68 -156.89 38 11 ASP A 32 ? ? 54.55 81.73 39 11 GLN A 139 ? ? 70.37 30.92 40 12 HIS A 5 ? ? -68.08 83.54 41 12 ASP A 32 ? ? 50.48 78.38 42 12 ASP A 91 ? ? -85.60 46.77 43 12 GLU A 124 ? ? -84.23 48.32 44 13 HIS A 5 ? ? -151.74 -8.61 45 13 SER A 9 ? ? 65.53 -0.84 46 13 TYR A 28 ? ? -42.07 106.07 47 14 HIS A 7 ? ? -61.29 90.57 48 14 HIS A 10 ? ? -79.94 -160.90 49 14 MET A 11 ? ? -65.31 85.69 50 14 SER A 27 ? ? -134.72 -30.31 51 14 TYR A 28 ? ? -69.62 86.61 52 14 LYS A 29 ? ? -142.12 26.39 53 14 ASN A 31 ? ? -132.10 -47.88 54 14 LYS A 69 ? ? -69.52 92.07 55 14 GLU A 159 ? ? 43.74 81.08 56 15 SER A 9 ? ? -63.02 96.97 57 15 GLU A 124 ? ? -97.52 55.53 58 16 LYS A 29 ? ? 60.12 -81.18 59 16 ASP A 32 ? ? 59.08 93.22 60 16 GLU A 124 ? ? -83.84 42.53 61 17 ASP A 32 ? ? 55.32 81.82 62 17 ASP A 91 ? ? -94.98 33.40 63 17 GLU A 124 ? ? -95.12 47.41 64 18 ASN A 31 ? ? -98.25 -85.69 65 18 ASP A 91 ? ? -85.41 43.95 66 18 GLU A 124 ? ? -92.95 45.33 67 19 MET A 11 ? ? -177.36 114.95 68 19 TYR A 28 ? ? 34.80 103.64 69 19 ASP A 91 ? ? -87.77 40.74 70 19 PRO A 110 ? ? -39.83 -37.31 71 19 GLU A 159 ? ? 54.49 85.64 72 20 HIS A 3 ? ? -96.25 32.85 73 20 HIS A 4 ? ? 64.20 97.22 74 20 ASP A 12 ? ? -95.76 -71.31 75 20 TYR A 28 ? ? -58.57 100.27 76 20 LYS A 29 ? ? -85.39 -83.68 77 20 ASP A 32 ? ? 64.96 100.46 78 20 GLU A 124 ? ? -87.36 49.72 #