data_2LAJ # _entry.id 2LAJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LAJ pdb_00002laj 10.2210/pdb2laj/pdb RCSB RCSB102161 ? ? BMRB 17529 ? 10.13018/BMR17529 WWPDB D_1000102161 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' struct_conn 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 3 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LAJ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-16 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 17529 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Macias, M.J.' 1 'Aragon, E.' 2 'Goerner, N.' 3 'Zaromytidou, A.' 4 'Xi, Q.' 5 'Escobedo, A.' 6 'Massague, J.' 7 # _citation.id primary _citation.title 'A Smad action turnover switch operated by WW domain readers of a phosphoserine code.' _citation.journal_abbrev 'Genes Dev.' _citation.journal_volume 25 _citation.page_first 1275 _citation.page_last 1288 _citation.year 2011 _citation.journal_id_ASTM GEDEEP _citation.country US _citation.journal_id_ISSN 0890-9369 _citation.journal_id_CSD 2056 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21685363 _citation.pdbx_database_id_DOI 10.1101/gad.2060811 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aragon, E.' 1 ? primary 'Goerner, N.' 2 ? primary 'Zaromytidou, A.I.' 3 ? primary 'Xi, Q.' 4 ? primary 'Escobedo, A.' 5 ? primary 'Massague, J.' 6 ? primary 'Macias, M.J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase NEDD4-like' 5210.877 1 6.3.2.- ? 'WW 3 domain residues 496-535' ? 2 polymer syn 'Mothers against decapentaplegic homolog 3' 1112.966 1 ? ? 'sequence database residues 202-211' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'NEDD4.2, Nedd4-2' 2 'MAD homolog 3, Mad3, Mothers against DPP homolog 3, hMAD-3, JV15-2, SMAD family member 3, SMAD 3, Smad3, hSMAD3' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GAMEQSFLPPGWEMRIAPNGRPFFYDHNTKTTTWEDPRLKFPVH GAMEQSFLPPGWEMRIAPNGRPFFYDHNTKTTTWEDPRLKFPVH A ? 2 'polypeptide(L)' no yes 'AG(SEP)PNL(SEP)PNP' AGSPNLSPNP B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLU n 1 5 GLN n 1 6 SER n 1 7 PHE n 1 8 LEU n 1 9 PRO n 1 10 PRO n 1 11 GLY n 1 12 TRP n 1 13 GLU n 1 14 MET n 1 15 ARG n 1 16 ILE n 1 17 ALA n 1 18 PRO n 1 19 ASN n 1 20 GLY n 1 21 ARG n 1 22 PRO n 1 23 PHE n 1 24 PHE n 1 25 TYR n 1 26 ASP n 1 27 HIS n 1 28 ASN n 1 29 THR n 1 30 LYS n 1 31 THR n 1 32 THR n 1 33 THR n 1 34 TRP n 1 35 GLU n 1 36 ASP n 1 37 PRO n 1 38 ARG n 1 39 LEU n 1 40 LYS n 1 41 PHE n 1 42 PRO n 1 43 VAL n 1 44 HIS n 2 1 ALA n 2 2 GLY n 2 3 SEP n 2 4 PRO n 2 5 ASN n 2 6 LEU n 2 7 SEP n 2 8 PRO n 2 9 ASN n 2 10 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NEDD4L, KIAA0439, NEDL3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector petM11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 472 ? ? ? A . n A 1 2 ALA 2 473 ? ? ? A . n A 1 3 MET 3 474 ? ? ? A . n A 1 4 GLU 4 475 ? ? ? A . n A 1 5 GLN 5 476 476 GLN GLN A . n A 1 6 SER 6 477 477 SER SER A . n A 1 7 PHE 7 478 478 PHE PHE A . n A 1 8 LEU 8 479 479 LEU LEU A . n A 1 9 PRO 9 480 480 PRO PRO A . n A 1 10 PRO 10 481 481 PRO PRO A . n A 1 11 GLY 11 482 482 GLY GLY A . n A 1 12 TRP 12 483 483 TRP TRP A . n A 1 13 GLU 13 484 484 GLU GLU A . n A 1 14 MET 14 485 485 MET MET A . n A 1 15 ARG 15 486 486 ARG ARG A . n A 1 16 ILE 16 487 487 ILE ILE A . n A 1 17 ALA 17 488 488 ALA ALA A . n A 1 18 PRO 18 489 489 PRO PRO A . n A 1 19 ASN 19 490 490 ASN ASN A . n A 1 20 GLY 20 491 491 GLY GLY A . n A 1 21 ARG 21 492 492 ARG ARG A . n A 1 22 PRO 22 493 493 PRO PRO A . n A 1 23 PHE 23 494 494 PHE PHE A . n A 1 24 PHE 24 495 495 PHE PHE A . n A 1 25 TYR 25 496 496 TYR TYR A . n A 1 26 ASP 26 497 497 ASP ASP A . n A 1 27 HIS 27 498 498 HIS HIS A . n A 1 28 ASN 28 499 499 ASN ASN A . n A 1 29 THR 29 500 500 THR THR A . n A 1 30 LYS 30 501 501 LYS LYS A . n A 1 31 THR 31 502 502 THR THR A . n A 1 32 THR 32 503 503 THR THR A . n A 1 33 THR 33 504 504 THR THR A . n A 1 34 TRP 34 505 505 TRP TRP A . n A 1 35 GLU 35 506 506 GLU GLU A . n A 1 36 ASP 36 507 507 ASP ASP A . n A 1 37 PRO 37 508 508 PRO PRO A . n A 1 38 ARG 38 509 509 ARG ARG A . n A 1 39 LEU 39 510 510 LEU LEU A . n A 1 40 LYS 40 511 511 LYS LYS A . n A 1 41 PHE 41 512 512 PHE PHE A . n A 1 42 PRO 42 513 513 PRO PRO A . n A 1 43 VAL 43 514 514 VAL VAL A . n A 1 44 HIS 44 515 515 HIS HIS A . n B 2 1 ALA 1 202 202 ALA ALA B . n B 2 2 GLY 2 203 203 GLY GLY B . n B 2 3 SEP 3 204 204 SEP SEP B . n B 2 4 PRO 4 205 205 PRO PRO B . n B 2 5 ASN 5 206 206 ASN ASN B . n B 2 6 LEU 6 207 207 LEU LEU B . n B 2 7 SEP 7 208 208 SEP SEP B . n B 2 8 PRO 8 209 209 PRO PRO B . n B 2 9 ASN 9 210 210 ASN ASN B . n B 2 10 PRO 10 211 211 PRO PRO B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;Third WW domain of human Nedd4L (residues 476-515) in complex with doubly phosphorylated human smad3 derived peptide (residues 202-211). ; _exptl.entry_id 2LAJ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LAJ _struct.title 'Third WW domain of human Nedd4L in complex with doubly phosphorylated human smad3 derived peptide' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LAJ _struct_keywords.pdbx_keywords 'LIGASE/TRANSCRIPTION REGULATOR' _struct_keywords.text 'CDK, signal transduction, LIGASE-TRANSCRIPTION REGULATOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP NED4L_HUMAN Q96PU5 1 QSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVH 496 ? 2 UNP SMAD3_HUMAN P84022 2 AGSPNLSPNP 202 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LAJ A 5 ? 44 ? Q96PU5 496 ? 535 ? 476 515 2 2 2LAJ B 1 ? 10 ? P84022 202 ? 211 ? 202 211 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LAJ GLY A 1 ? UNP Q96PU5 ? ? 'expression tag' 472 1 1 2LAJ ALA A 2 ? UNP Q96PU5 ? ? 'expression tag' 473 2 1 2LAJ MET A 3 ? UNP Q96PU5 ? ? 'expression tag' 474 3 1 2LAJ GLU A 4 ? UNP Q96PU5 ? ? 'expression tag' 475 4 1 2LAJ TYR A 25 ? UNP Q96PU5 ILE 516 'engineered mutation' 496 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 36 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id HIS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 44 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 507 _struct_conf.end_auth_comp_id HIS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 515 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLY 2 C ? ? ? 1_555 B SEP 3 N ? ? B GLY 203 B SEP 204 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale2 covale both ? B SEP 3 C ? ? ? 1_555 B PRO 4 N ? ? B SEP 204 B PRO 205 1_555 ? ? ? ? ? ? ? 1.336 ? ? covale3 covale both ? B LEU 6 C ? ? ? 1_555 B SEP 7 N ? ? B LEU 207 B SEP 208 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? B SEP 7 C ? ? ? 1_555 B PRO 8 N ? ? B SEP 208 B PRO 209 1_555 ? ? ? ? ? ? ? 1.344 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 SEP B 3 ? . . . . SEP B 204 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' 2 SEP B 7 ? . . . . SEP B 208 ? 1_555 . . . . . . . SER 1 SEP Phosphorylation 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 12 ? ALA A 17 ? TRP A 483 ALA A 488 A 2 ARG A 21 ? ASP A 26 ? ARG A 492 ASP A 497 A 3 THR A 31 ? THR A 33 ? THR A 502 THR A 504 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 17 ? N ALA A 488 O ARG A 21 ? O ARG A 492 A 2 3 N PHE A 24 ? N PHE A 495 O THR A 33 ? O THR A 504 # _pdbx_entry_details.entry_id 2LAJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HD11 A LEU 479 ? ? HG2 A PRO 508 ? ? 1.30 2 2 H3 B ALA 202 ? ? O3P B SEP 204 ? ? 1.56 3 3 HG3 A PRO 480 ? ? HE1 A PHE 512 ? ? 1.34 4 3 H2 B ALA 202 ? ? O1P B SEP 204 ? ? 1.56 5 4 HD11 A LEU 479 ? ? HG2 A PRO 508 ? ? 1.31 6 5 HG3 A PRO 480 ? ? HE1 A PHE 512 ? ? 1.23 7 5 HZ2 A TRP 483 ? ? HZ3 A LYS 511 ? ? 1.23 8 5 H3 B ALA 202 ? ? O3P B SEP 204 ? ? 1.60 9 8 HG3 A PRO 480 ? ? HE1 A PHE 512 ? ? 1.19 10 8 HD22 A ASN 490 ? ? O1P B SEP 208 ? ? 1.55 11 9 HD13 A LEU 479 ? ? HG2 A PRO 508 ? ? 1.30 12 9 HE3 A LYS 511 ? ? HG12 A VAL 514 ? ? 1.32 13 9 HE2 A PHE 478 ? ? HB2 A MET 485 ? ? 1.33 14 10 HG3 A PRO 480 ? ? HE1 A PHE 512 ? ? 1.19 15 11 HG3 A PRO 480 ? ? HE1 A PHE 512 ? ? 1.10 16 11 OD1 A ASP 497 ? ? HZ3 A LYS 511 ? ? 1.59 17 12 HD22 A ASN 490 ? ? O1P B SEP 208 ? ? 1.50 18 12 H2 B ALA 202 ? ? O1P B SEP 204 ? ? 1.58 19 14 HG1 A THR 503 ? ? HG3 B PRO 209 ? ? 1.20 20 15 HB2 A GLN 476 ? ? HB3 A LEU 479 ? ? 1.23 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 93.74 110.40 -16.66 2.00 N 2 1 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.68 120.80 -5.12 0.70 N 3 2 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 97.07 110.40 -13.33 2.00 N 4 3 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.78 110.40 -14.62 2.00 N 5 3 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.20 120.80 -5.60 0.70 N 6 4 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.50 110.40 -14.90 2.00 N 7 4 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.65 120.80 -5.15 0.70 N 8 5 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.60 110.40 -14.80 2.00 N 9 5 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 114.99 120.80 -5.81 0.70 N 10 6 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 97.52 110.40 -12.88 2.00 N 11 6 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.88 120.80 -4.92 0.70 N 12 7 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 93.87 110.40 -16.53 2.00 N 13 7 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 116.39 120.80 -4.41 0.70 N 14 8 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 96.59 110.40 -13.81 2.00 N 15 8 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 114.74 120.80 -6.06 0.70 N 16 9 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 96.42 110.40 -13.98 2.00 N 17 9 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 114.89 120.80 -5.91 0.70 N 18 9 C A PHE 512 ? ? N A PRO 513 ? ? CA A PRO 513 ? ? 128.62 119.30 9.32 1.50 Y 19 10 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.77 110.40 -14.63 2.00 N 20 11 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 96.22 110.40 -14.18 2.00 N 21 11 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 114.76 120.80 -6.04 0.70 N 22 12 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 94.74 110.40 -15.66 2.00 N 23 12 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.40 120.80 -5.40 0.70 N 24 12 CB A PHE 494 ? ? CG A PHE 494 ? ? CD1 A PHE 494 ? ? 125.19 120.80 4.39 0.70 N 25 13 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.96 110.40 -14.44 2.00 N 26 13 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 116.28 120.80 -4.52 0.70 N 27 14 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.29 110.40 -15.11 2.00 N 28 14 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.45 120.80 -5.35 0.70 N 29 15 CB A PHE 478 ? ? CA A PHE 478 ? ? C A PHE 478 ? ? 95.88 110.40 -14.52 2.00 N 30 15 CB A PHE 478 ? ? CG A PHE 478 ? ? CD2 A PHE 478 ? ? 115.40 120.80 -5.40 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 480 ? ? -59.89 174.05 2 1 PRO A 481 ? ? -79.30 38.30 3 1 PRO A 489 ? ? -56.36 1.86 4 1 PRO A 513 ? ? -48.96 -9.63 5 1 PRO B 205 ? ? -59.62 100.03 6 1 LEU B 207 ? ? -63.21 99.24 7 2 PRO A 481 ? ? -88.59 30.16 8 2 PRO A 489 ? ? -54.38 2.78 9 2 PRO A 513 ? ? -48.73 -9.51 10 2 VAL A 514 ? ? -58.22 -9.67 11 2 PRO B 205 ? ? -59.53 98.22 12 3 PRO A 481 ? ? -79.52 29.15 13 3 PRO A 489 ? ? -55.95 0.94 14 3 PRO A 513 ? ? -50.86 -9.70 15 3 PRO B 205 ? ? -59.68 98.48 16 4 PRO A 480 ? ? -59.82 173.96 17 4 PRO A 481 ? ? -78.22 36.00 18 4 PRO A 489 ? ? -54.96 -3.78 19 4 PHE A 512 ? ? -39.63 -39.69 20 4 PRO A 513 ? ? -49.63 -9.61 21 4 VAL A 514 ? ? -57.47 -9.50 22 4 PRO B 205 ? ? -59.58 106.24 23 5 PRO A 480 ? ? -59.78 171.54 24 5 PRO A 481 ? ? -74.79 28.83 25 5 PRO A 489 ? ? -57.67 -2.19 26 5 PRO A 513 ? ? -50.40 -9.85 27 5 VAL A 514 ? ? -59.96 -9.61 28 6 SER A 477 ? ? -120.15 -75.24 29 6 PRO A 481 ? ? -80.17 34.86 30 6 PRO A 489 ? ? -52.68 -4.11 31 6 PRO A 513 ? ? -48.06 -9.42 32 6 VAL A 514 ? ? -57.35 -9.86 33 6 PRO B 205 ? ? -59.63 106.25 34 6 LEU B 207 ? ? -61.47 99.89 35 7 PRO A 481 ? ? -78.12 36.74 36 7 PRO A 489 ? ? -57.83 5.44 37 7 ASN A 499 ? ? -164.60 -74.43 38 7 PHE A 512 ? ? -39.96 -32.08 39 7 PRO A 513 ? ? -46.95 -8.90 40 7 VAL A 514 ? ? -46.43 -9.86 41 7 PRO B 205 ? ? -59.65 105.68 42 8 PRO A 480 ? ? -59.80 171.82 43 8 PRO A 481 ? ? -77.51 24.48 44 8 PRO A 489 ? ? -57.61 -4.16 45 8 PHE A 512 ? ? -39.67 -39.31 46 8 PRO A 513 ? ? -50.98 -9.62 47 8 PRO B 205 ? ? -59.62 102.76 48 9 PRO A 480 ? ? -59.91 174.38 49 9 PRO A 481 ? ? -74.43 24.62 50 9 PRO A 489 ? ? -52.78 -3.19 51 9 PRO A 513 ? ? -42.81 -8.92 52 9 VAL A 514 ? ? -45.39 -9.74 53 9 PRO B 205 ? ? -59.60 106.09 54 10 PRO A 480 ? ? -59.86 170.65 55 10 PRO A 481 ? ? -77.09 35.07 56 10 PRO A 489 ? ? -58.82 5.73 57 10 PRO B 205 ? ? -59.98 105.70 58 11 SER A 477 ? ? -96.92 -75.25 59 11 PRO A 480 ? ? -59.95 175.28 60 11 PRO A 481 ? ? -79.22 30.68 61 11 PRO A 489 ? ? -59.70 3.20 62 11 PRO B 205 ? ? -59.41 100.39 63 12 PRO A 481 ? ? -78.74 34.61 64 12 PRO A 489 ? ? -56.90 1.79 65 12 PRO A 513 ? ? -46.63 -9.70 66 12 PRO B 205 ? ? -59.67 109.68 67 13 PRO A 489 ? ? -54.55 -4.57 68 13 PHE A 512 ? ? -39.36 -33.58 69 13 PRO A 513 ? ? -43.76 -9.13 70 13 VAL A 514 ? ? -48.02 -9.82 71 14 PRO A 481 ? ? -79.23 36.02 72 14 PRO A 489 ? ? -58.00 4.28 73 14 PHE A 512 ? ? -39.33 -35.76 74 14 PRO A 513 ? ? -42.51 -8.88 75 14 VAL A 514 ? ? -41.45 -9.73 76 14 PRO B 205 ? ? -59.54 98.83 77 15 PRO A 480 ? ? -59.93 172.65 78 15 PRO A 481 ? ? -74.42 29.16 79 15 PRO A 489 ? ? -54.41 -2.51 80 15 PHE A 512 ? ? -39.65 -38.11 81 15 PRO A 513 ? ? -45.87 -9.84 82 15 PRO B 205 ? ? -59.86 108.04 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 PHE A 478 ? ? LEU A 479 ? ? -132.73 2 1 GLY A 482 ? ? TRP A 483 ? ? -141.84 3 2 PHE A 478 ? ? LEU A 479 ? ? -134.07 4 2 GLY A 482 ? ? TRP A 483 ? ? -138.68 5 3 PHE A 478 ? ? LEU A 479 ? ? -131.71 6 3 GLY A 482 ? ? TRP A 483 ? ? -143.28 7 4 PHE A 478 ? ? LEU A 479 ? ? -132.27 8 4 GLY A 482 ? ? TRP A 483 ? ? -142.03 9 5 PHE A 478 ? ? LEU A 479 ? ? -131.29 10 5 GLY A 482 ? ? TRP A 483 ? ? -141.46 11 6 PHE A 478 ? ? LEU A 479 ? ? -130.29 12 6 GLY A 482 ? ? TRP A 483 ? ? -140.10 13 7 PHE A 478 ? ? LEU A 479 ? ? -133.21 14 7 GLY A 482 ? ? TRP A 483 ? ? -142.54 15 8 PHE A 478 ? ? LEU A 479 ? ? -130.67 16 8 GLY A 482 ? ? TRP A 483 ? ? -141.96 17 9 PHE A 478 ? ? LEU A 479 ? ? -129.79 18 9 GLY A 482 ? ? TRP A 483 ? ? -142.35 19 10 PHE A 478 ? ? LEU A 479 ? ? -130.01 20 10 GLY A 482 ? ? TRP A 483 ? ? -141.88 21 11 PHE A 478 ? ? LEU A 479 ? ? -130.78 22 11 GLY A 482 ? ? TRP A 483 ? ? -141.90 23 12 PHE A 478 ? ? LEU A 479 ? ? -131.45 24 12 GLY A 482 ? ? TRP A 483 ? ? -141.61 25 13 PHE A 478 ? ? LEU A 479 ? ? -130.39 26 13 GLY A 482 ? ? TRP A 483 ? ? -141.03 27 14 PHE A 478 ? ? LEU A 479 ? ? -131.70 28 14 GLY A 482 ? ? TRP A 483 ? ? -141.74 29 15 PHE A 478 ? ? LEU A 479 ? ? -134.57 30 15 GLY A 482 ? ? TRP A 483 ? ? -144.88 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B SEP 3 B SEP 204 ? SER PHOSPHOSERINE 2 B SEP 7 B SEP 208 ? SER PHOSPHOSERINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LAJ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LAJ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NEDD4LWW3-1 1 ? mM ? 1 SMAD3-2 3 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 'sodium azide-5' 2 ? mM ? 1 NEDD4LWW3-6 1 ? mM '[U-100% 15N]' 2 SMAD3-7 3 ? mM ? 2 'sodium phosphate-8' 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'sodium azide-10' 2 ? mM ? 2 NEDD4LWW3-11 1 ? mM '[U-100% 13C; U-100% 15N]' 3 SMAD3-12 3 ? mM ? 3 'sodium phosphate-13' 20 ? mM ? 3 'sodium chloride-14' 100 ? mM ? 3 'sodium azide-15' 2 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.420 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 3 '3D CBCA(CO)NH' 1 4 3 '3D HNCACB' 1 5 2 '2D 1H-15N HSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LAJ _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 448 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 237 _pdbx_nmr_constraints.NOE_medium_range_total_count 53 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 174 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LAJ _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.3 1 'Bartels et al.' 'chemical shift assignment' XEASY ? 2 'Bruker Biospin' collection TopSpin ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.3 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 472 ? A GLY 1 2 1 Y 1 A ALA 473 ? A ALA 2 3 1 Y 1 A MET 474 ? A MET 3 4 1 Y 1 A GLU 475 ? A GLU 4 5 2 Y 1 A GLY 472 ? A GLY 1 6 2 Y 1 A ALA 473 ? A ALA 2 7 2 Y 1 A MET 474 ? A MET 3 8 2 Y 1 A GLU 475 ? A GLU 4 9 3 Y 1 A GLY 472 ? A GLY 1 10 3 Y 1 A ALA 473 ? A ALA 2 11 3 Y 1 A MET 474 ? A MET 3 12 3 Y 1 A GLU 475 ? A GLU 4 13 4 Y 1 A GLY 472 ? A GLY 1 14 4 Y 1 A ALA 473 ? A ALA 2 15 4 Y 1 A MET 474 ? A MET 3 16 4 Y 1 A GLU 475 ? A GLU 4 17 5 Y 1 A GLY 472 ? A GLY 1 18 5 Y 1 A ALA 473 ? A ALA 2 19 5 Y 1 A MET 474 ? A MET 3 20 5 Y 1 A GLU 475 ? A GLU 4 21 6 Y 1 A GLY 472 ? A GLY 1 22 6 Y 1 A ALA 473 ? A ALA 2 23 6 Y 1 A MET 474 ? A MET 3 24 6 Y 1 A GLU 475 ? A GLU 4 25 7 Y 1 A GLY 472 ? A GLY 1 26 7 Y 1 A ALA 473 ? A ALA 2 27 7 Y 1 A MET 474 ? A MET 3 28 7 Y 1 A GLU 475 ? A GLU 4 29 8 Y 1 A GLY 472 ? A GLY 1 30 8 Y 1 A ALA 473 ? A ALA 2 31 8 Y 1 A MET 474 ? A MET 3 32 8 Y 1 A GLU 475 ? A GLU 4 33 9 Y 1 A GLY 472 ? A GLY 1 34 9 Y 1 A ALA 473 ? A ALA 2 35 9 Y 1 A MET 474 ? A MET 3 36 9 Y 1 A GLU 475 ? A GLU 4 37 10 Y 1 A GLY 472 ? A GLY 1 38 10 Y 1 A ALA 473 ? A ALA 2 39 10 Y 1 A MET 474 ? A MET 3 40 10 Y 1 A GLU 475 ? A GLU 4 41 11 Y 1 A GLY 472 ? A GLY 1 42 11 Y 1 A ALA 473 ? A ALA 2 43 11 Y 1 A MET 474 ? A MET 3 44 11 Y 1 A GLU 475 ? A GLU 4 45 12 Y 1 A GLY 472 ? A GLY 1 46 12 Y 1 A ALA 473 ? A ALA 2 47 12 Y 1 A MET 474 ? A MET 3 48 12 Y 1 A GLU 475 ? A GLU 4 49 13 Y 1 A GLY 472 ? A GLY 1 50 13 Y 1 A ALA 473 ? A ALA 2 51 13 Y 1 A MET 474 ? A MET 3 52 13 Y 1 A GLU 475 ? A GLU 4 53 14 Y 1 A GLY 472 ? A GLY 1 54 14 Y 1 A ALA 473 ? A ALA 2 55 14 Y 1 A MET 474 ? A MET 3 56 14 Y 1 A GLU 475 ? A GLU 4 57 15 Y 1 A GLY 472 ? A GLY 1 58 15 Y 1 A ALA 473 ? A ALA 2 59 15 Y 1 A MET 474 ? A MET 3 60 15 Y 1 A GLU 475 ? A GLU 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SEP N N N N 273 SEP CA C N S 274 SEP CB C N N 275 SEP OG O N N 276 SEP C C N N 277 SEP O O N N 278 SEP OXT O N N 279 SEP P P N N 280 SEP O1P O N N 281 SEP O2P O N N 282 SEP O3P O N N 283 SEP H H N N 284 SEP H2 H N N 285 SEP HA H N N 286 SEP HB2 H N N 287 SEP HB3 H N N 288 SEP HXT H N N 289 SEP HOP2 H N N 290 SEP HOP3 H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SEP N CA sing N N 262 SEP N H sing N N 263 SEP N H2 sing N N 264 SEP CA CB sing N N 265 SEP CA C sing N N 266 SEP CA HA sing N N 267 SEP CB OG sing N N 268 SEP CB HB2 sing N N 269 SEP CB HB3 sing N N 270 SEP OG P sing N N 271 SEP C O doub N N 272 SEP C OXT sing N N 273 SEP OXT HXT sing N N 274 SEP P O1P doub N N 275 SEP P O2P sing N N 276 SEP P O3P sing N N 277 SEP O2P HOP2 sing N N 278 SEP O3P HOP3 sing N N 279 SER N CA sing N N 280 SER N H sing N N 281 SER N H2 sing N N 282 SER CA C sing N N 283 SER CA CB sing N N 284 SER CA HA sing N N 285 SER C O doub N N 286 SER C OXT sing N N 287 SER CB OG sing N N 288 SER CB HB2 sing N N 289 SER CB HB3 sing N N 290 SER OG HG sing N N 291 SER OXT HXT sing N N 292 THR N CA sing N N 293 THR N H sing N N 294 THR N H2 sing N N 295 THR CA C sing N N 296 THR CA CB sing N N 297 THR CA HA sing N N 298 THR C O doub N N 299 THR C OXT sing N N 300 THR CB OG1 sing N N 301 THR CB CG2 sing N N 302 THR CB HB sing N N 303 THR OG1 HG1 sing N N 304 THR CG2 HG21 sing N N 305 THR CG2 HG22 sing N N 306 THR CG2 HG23 sing N N 307 THR OXT HXT sing N N 308 TRP N CA sing N N 309 TRP N H sing N N 310 TRP N H2 sing N N 311 TRP CA C sing N N 312 TRP CA CB sing N N 313 TRP CA HA sing N N 314 TRP C O doub N N 315 TRP C OXT sing N N 316 TRP CB CG sing N N 317 TRP CB HB2 sing N N 318 TRP CB HB3 sing N N 319 TRP CG CD1 doub Y N 320 TRP CG CD2 sing Y N 321 TRP CD1 NE1 sing Y N 322 TRP CD1 HD1 sing N N 323 TRP CD2 CE2 doub Y N 324 TRP CD2 CE3 sing Y N 325 TRP NE1 CE2 sing Y N 326 TRP NE1 HE1 sing N N 327 TRP CE2 CZ2 sing Y N 328 TRP CE3 CZ3 doub Y N 329 TRP CE3 HE3 sing N N 330 TRP CZ2 CH2 doub Y N 331 TRP CZ2 HZ2 sing N N 332 TRP CZ3 CH2 sing Y N 333 TRP CZ3 HZ3 sing N N 334 TRP CH2 HH2 sing N N 335 TRP OXT HXT sing N N 336 TYR N CA sing N N 337 TYR N H sing N N 338 TYR N H2 sing N N 339 TYR CA C sing N N 340 TYR CA CB sing N N 341 TYR CA HA sing N N 342 TYR C O doub N N 343 TYR C OXT sing N N 344 TYR CB CG sing N N 345 TYR CB HB2 sing N N 346 TYR CB HB3 sing N N 347 TYR CG CD1 doub Y N 348 TYR CG CD2 sing Y N 349 TYR CD1 CE1 sing Y N 350 TYR CD1 HD1 sing N N 351 TYR CD2 CE2 doub Y N 352 TYR CD2 HD2 sing N N 353 TYR CE1 CZ doub Y N 354 TYR CE1 HE1 sing N N 355 TYR CE2 CZ sing Y N 356 TYR CE2 HE2 sing N N 357 TYR CZ OH sing N N 358 TYR OH HH sing N N 359 TYR OXT HXT sing N N 360 VAL N CA sing N N 361 VAL N H sing N N 362 VAL N H2 sing N N 363 VAL CA C sing N N 364 VAL CA CB sing N N 365 VAL CA HA sing N N 366 VAL C O doub N N 367 VAL C OXT sing N N 368 VAL CB CG1 sing N N 369 VAL CB CG2 sing N N 370 VAL CB HB sing N N 371 VAL CG1 HG11 sing N N 372 VAL CG1 HG12 sing N N 373 VAL CG1 HG13 sing N N 374 VAL CG2 HG21 sing N N 375 VAL CG2 HG22 sing N N 376 VAL CG2 HG23 sing N N 377 VAL OXT HXT sing N N 378 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2LAJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ #