data_2LAX # _entry.id 2LAX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2LAX RCSB RCSB102173 BMRB 17539 WWPDB D_1000102173 # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17539 BMRB unspecified . 2LAW PDB unspecified . 2LAY PDB unspecified . 2LAZ PDB unspecified . 2LB0 PDB unspecified . 2LB1 PDB unspecified . 2LB2 PDB unspecified . 2LB3 PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LAX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Macias, M.J.' 1 'Aragon, E.' 2 'Goerner, N.' 3 'Zaromytidou, A.' 4 'Xi, Q.' 5 'Escobedo, A.' 6 'Massague, J.' 7 # _citation.id primary _citation.title 'A Smad action turnover switch operated by WW domain readers of a phosphoserine code.' _citation.journal_abbrev 'Genes Dev.' _citation.journal_volume 25 _citation.page_first 1275 _citation.page_last 1288 _citation.year 2011 _citation.journal_id_ASTM GEDEEP _citation.country US _citation.journal_id_ISSN 0890-9369 _citation.journal_id_CSD 2056 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21685363 _citation.pdbx_database_id_DOI 10.1101/gad.2060811 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Aragon, E.' 1 primary 'Goerner, N.' 2 primary 'Zaromytidou, A.I.' 3 primary 'Xi, Q.' 4 primary 'Escobedo, A.' 5 primary 'Massague, J.' 6 primary 'Macias, M.J.' 7 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Yorkie homolog' 4540.034 1 ? ? 'first WW domain, residues 170-205' ? 2 polymer syn 'Mothers against decapentaplegic homolog 1' 1136.965 1 ? ? 'residues 201-209' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 '65 kDa Yes-associated protein, YAP65' 2 ;MAD homolog 1, Mothers against DPP homolog 1, JV4-1, Mad-related protein 1, SMAD family member 1, SMAD 1, Smad1, hSMAD1, Transforming growth factor-beta-signaling protein 1, BSP-1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GAMEDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA GAMEDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA A ? 2 'polypeptide(L)' no yes 'S(TPO)YPH(SEP)PTS' STYPHSPTS B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLU n 1 5 ASP n 1 6 VAL n 1 7 PRO n 1 8 LEU n 1 9 PRO n 1 10 ALA n 1 11 GLY n 1 12 TRP n 1 13 GLU n 1 14 MET n 1 15 ALA n 1 16 LYS n 1 17 THR n 1 18 SER n 1 19 SER n 1 20 GLY n 1 21 GLN n 1 22 ARG n 1 23 TYR n 1 24 PHE n 1 25 LEU n 1 26 ASN n 1 27 HIS n 1 28 ILE n 1 29 ASP n 1 30 GLN n 1 31 THR n 1 32 THR n 1 33 THR n 1 34 TRP n 1 35 GLN n 1 36 ASP n 1 37 PRO n 1 38 ARG n 1 39 LYS n 1 40 ALA n 2 1 SER n 2 2 TPO n 2 3 TYR n 2 4 PRO n 2 5 HIS n 2 6 SEP n 2 7 PRO n 2 8 THR n 2 9 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'YAP1, YAP65' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector petM11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP YAP1_HUMAN P46937 1 DVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKA 170 ? 2 UNP SMAD1_HUMAN Q15797 2 STYPHSPTS 201 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LAX A 5 ? 40 ? P46937 170 ? 205 ? 170 205 2 2 2LAX B 1 ? 9 ? Q15797 201 ? 209 ? 201 209 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2LAX GLY A 1 ? UNP P46937 ? ? 'EXPRESSION TAG' 166 1 1 2LAX ALA A 2 ? UNP P46937 ? ? 'EXPRESSION TAG' 167 2 1 2LAX MET A 3 ? UNP P46937 ? ? 'EXPRESSION TAG' 168 3 1 2LAX GLU A 4 ? UNP P46937 ? ? 'EXPRESSION TAG' 169 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 3 '3D CBCA(CO)NH' 1 4 3 '3D HNCACB' 1 5 2 '2D 1H-15N HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.420 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2LAX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LAX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LAX _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.3 1 'Bartels et al.' 'chemical shift assignment' XEASY ? 2 'Bruker Biospin' collection TOPSPIN ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 ? refinement CNS ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Structure of first WW domain of human YAP in complex with a human Smad1 doubly-phosphorilated derived peptide.' _exptl.entry_id 2LAX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LAX _struct.title 'Structure of first WW domain of human YAP in complex with a human Smad1 doubly-phosphorilated derived peptide.' _struct.pdbx_descriptor 'Yorkie homolog, Mothers against decapentaplegic homolog 1' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LAX _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/TRANSCRIPTION' _struct_keywords.text 'YAP, SMAD, CDK, signal transduction, SIGNALING PROTEIN-TRANSCRIPTION complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B SER 1 C ? ? ? 1_555 B TPO 2 N ? ? B SER 201 B TPO 202 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale ? ? B TPO 2 C ? ? ? 1_555 B TYR 3 N ? ? B TPO 202 B TYR 203 1_555 ? ? ? ? ? ? ? 1.331 ? covale3 covale ? ? B HIS 5 C ? ? ? 1_555 B SEP 6 N ? ? B HIS 205 B SEP 206 1_555 ? ? ? ? ? ? ? 1.325 ? covale4 covale ? ? B SEP 6 C ? ? ? 1_555 B PRO 7 N ? ? B SEP 206 B PRO 207 1_555 ? ? ? ? ? ? ? 1.347 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 12 ? THR A 17 ? TRP A 177 THR A 182 A 2 GLN A 21 ? ASN A 26 ? GLN A 186 ASN A 191 A 3 THR A 31 ? THR A 33 ? THR A 196 THR A 198 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 17 ? N THR A 182 O GLN A 21 ? O GLN A 186 A 2 3 N PHE A 24 ? N PHE A 189 O THR A 33 ? O THR A 198 # _atom_sites.entry_id 2LAX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 166 ? ? ? A . n A 1 2 ALA 2 167 ? ? ? A . n A 1 3 MET 3 168 ? ? ? A . n A 1 4 GLU 4 169 ? ? ? A . n A 1 5 ASP 5 170 170 ASP ASP A . n A 1 6 VAL 6 171 171 VAL VAL A . n A 1 7 PRO 7 172 172 PRO PRO A . n A 1 8 LEU 8 173 173 LEU LEU A . n A 1 9 PRO 9 174 174 PRO PRO A . n A 1 10 ALA 10 175 175 ALA ALA A . n A 1 11 GLY 11 176 176 GLY GLY A . n A 1 12 TRP 12 177 177 TRP TRP A . n A 1 13 GLU 13 178 178 GLU GLU A . n A 1 14 MET 14 179 179 MET MET A . n A 1 15 ALA 15 180 180 ALA ALA A . n A 1 16 LYS 16 181 181 LYS LYS A . n A 1 17 THR 17 182 182 THR THR A . n A 1 18 SER 18 183 183 SER SER A . n A 1 19 SER 19 184 184 SER SER A . n A 1 20 GLY 20 185 185 GLY GLY A . n A 1 21 GLN 21 186 186 GLN GLN A . n A 1 22 ARG 22 187 187 ARG ARG A . n A 1 23 TYR 23 188 188 TYR TYR A . n A 1 24 PHE 24 189 189 PHE PHE A . n A 1 25 LEU 25 190 190 LEU LEU A . n A 1 26 ASN 26 191 191 ASN ASN A . n A 1 27 HIS 27 192 192 HIS HIS A . n A 1 28 ILE 28 193 193 ILE ILE A . n A 1 29 ASP 29 194 194 ASP ASP A . n A 1 30 GLN 30 195 195 GLN GLN A . n A 1 31 THR 31 196 196 THR THR A . n A 1 32 THR 32 197 197 THR THR A . n A 1 33 THR 33 198 198 THR THR A . n A 1 34 TRP 34 199 199 TRP TRP A . n A 1 35 GLN 35 200 200 GLN GLN A . n A 1 36 ASP 36 201 201 ASP ASP A . n A 1 37 PRO 37 202 202 PRO PRO A . n A 1 38 ARG 38 203 203 ARG ARG A . n A 1 39 LYS 39 204 204 LYS LYS A . n A 1 40 ALA 40 205 205 ALA ALA A . n B 2 1 SER 1 201 201 SER SER B . n B 2 2 TPO 2 202 202 TPO TPO B . n B 2 3 TYR 3 203 203 TYR TYR B . n B 2 4 PRO 4 204 204 PRO PRO B . n B 2 5 HIS 5 205 205 HIS HIS B . n B 2 6 SEP 6 206 206 SEP SEP B . n B 2 7 PRO 7 207 207 PRO PRO B . n B 2 8 THR 8 208 208 THR THR B . n B 2 9 SER 9 209 209 SER SER B . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B TPO 2 B TPO 202 ? THR PHOSPHOTHREONINE 2 B SEP 6 B SEP 206 ? SER PHOSPHOSERINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-06 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NEDD4LWW3-1 1 ? mM ? 1 SMAD3-2 3 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 'sodium azide-5' 2 ? mM ? 1 NEDD4LWW3-6 1 ? mM '[U-100% 15N]' 2 SMAD3-7 3 ? mM ? 2 'sodium phosphate-8' 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'sodium azide-10' 2 ? mM ? 2 NEDD4LWW3-11 1 ? mM '[U-100% 13C; U-100% 15N]' 3 SMAD3-12 3 ? mM ? 3 'sodium phosphate-13' 20 ? mM ? 3 'sodium chloride-14' 100 ? mM ? 3 'sodium azide-15' 2 ? mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LAX _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 10 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 600 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 248 _pdbx_nmr_constraints.NOE_medium_range_total_count 81 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 170 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H1 B SER 201 ? ? O2P B TPO 202 ? ? 1.59 2 2 O B THR 208 ? ? HG B SER 209 ? ? 1.58 3 3 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.31 4 4 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 5 4 HZ1 A LYS 204 ? ? O A ALA 205 ? ? 1.58 6 4 HH21 A ARG 187 ? ? OD2 A ASP 201 ? ? 1.59 7 5 HB2 B PRO 204 ? ? H B HIS 205 ? ? 1.33 8 7 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.30 9 9 HB3 A GLU 178 ? ? HB2 A LEU 190 ? ? 1.33 10 10 OE1 A GLU 178 ? ? HE2 A HIS 192 ? ? 1.59 11 10 OD2 A ASP 194 ? ? HG1 A THR 196 ? ? 1.60 12 11 HZ1 A LYS 204 ? ? OXT A ALA 205 ? ? 1.59 13 20 OD2 A ASP 194 ? ? HG1 A THR 196 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO B 204 ? ? -80.35 -133.80 2 2 PRO B 204 ? ? -73.41 -141.80 3 2 THR B 208 ? ? -117.77 -110.01 4 3 PRO B 204 ? ? -86.51 -128.48 5 4 PRO B 204 ? ? -69.00 -166.61 6 4 THR B 208 ? ? -89.90 -94.33 7 5 TYR B 203 ? ? 69.61 107.90 8 5 PRO B 204 ? ? -84.95 -121.61 9 6 TYR B 203 ? ? -175.53 119.02 10 6 PRO B 204 ? ? -75.47 -134.03 11 7 PRO B 204 ? ? -78.38 -131.09 12 8 TYR B 203 ? ? 66.88 108.72 13 10 PRO B 204 ? ? -84.59 -127.77 14 11 PRO B 204 ? ? -82.26 -133.24 15 12 GLN A 195 ? ? 64.58 74.96 16 12 PRO B 204 ? ? -82.02 -145.81 17 13 TPO B 202 ? ? 63.40 95.08 18 13 PRO B 204 ? ? -78.04 -113.70 19 14 PRO B 204 ? ? -82.38 -126.20 20 15 TPO B 202 ? ? -124.86 -97.44 21 15 TYR B 203 ? ? -179.35 128.85 22 15 PRO B 204 ? ? -78.59 -128.89 23 15 HIS B 205 ? ? -150.08 5.54 24 15 SEP B 206 ? ? 51.39 135.53 25 16 TYR B 203 ? ? -129.78 -55.06 26 16 PRO B 204 ? ? -96.63 -143.51 27 17 GLN A 195 ? ? 72.08 31.82 28 17 PRO B 204 ? ? -75.56 -126.11 29 18 TYR B 203 ? ? 73.36 122.64 30 18 PRO B 204 ? ? -77.07 -129.30 31 19 ARG A 203 ? ? -99.11 -66.17 32 19 TPO B 202 ? ? -139.39 -33.98 33 19 PRO B 204 ? ? -81.45 -124.49 34 20 PRO B 204 ? ? -72.42 -139.66 35 20 HIS B 205 ? ? -150.11 56.66 36 20 SEP B 206 ? ? 61.28 150.40 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 166 ? A GLY 1 2 1 Y 1 A ALA 167 ? A ALA 2 3 1 Y 1 A MET 168 ? A MET 3 4 1 Y 1 A GLU 169 ? A GLU 4 5 2 Y 1 A GLY 166 ? A GLY 1 6 2 Y 1 A ALA 167 ? A ALA 2 7 2 Y 1 A MET 168 ? A MET 3 8 2 Y 1 A GLU 169 ? A GLU 4 9 3 Y 1 A GLY 166 ? A GLY 1 10 3 Y 1 A ALA 167 ? A ALA 2 11 3 Y 1 A MET 168 ? A MET 3 12 3 Y 1 A GLU 169 ? A GLU 4 13 4 Y 1 A GLY 166 ? A GLY 1 14 4 Y 1 A ALA 167 ? A ALA 2 15 4 Y 1 A MET 168 ? A MET 3 16 4 Y 1 A GLU 169 ? A GLU 4 17 5 Y 1 A GLY 166 ? A GLY 1 18 5 Y 1 A ALA 167 ? A ALA 2 19 5 Y 1 A MET 168 ? A MET 3 20 5 Y 1 A GLU 169 ? A GLU 4 21 6 Y 1 A GLY 166 ? A GLY 1 22 6 Y 1 A ALA 167 ? A ALA 2 23 6 Y 1 A MET 168 ? A MET 3 24 6 Y 1 A GLU 169 ? A GLU 4 25 7 Y 1 A GLY 166 ? A GLY 1 26 7 Y 1 A ALA 167 ? A ALA 2 27 7 Y 1 A MET 168 ? A MET 3 28 7 Y 1 A GLU 169 ? A GLU 4 29 8 Y 1 A GLY 166 ? A GLY 1 30 8 Y 1 A ALA 167 ? A ALA 2 31 8 Y 1 A MET 168 ? A MET 3 32 8 Y 1 A GLU 169 ? A GLU 4 33 9 Y 1 A GLY 166 ? A GLY 1 34 9 Y 1 A ALA 167 ? A ALA 2 35 9 Y 1 A MET 168 ? A MET 3 36 9 Y 1 A GLU 169 ? A GLU 4 37 10 Y 1 A GLY 166 ? A GLY 1 38 10 Y 1 A ALA 167 ? A ALA 2 39 10 Y 1 A MET 168 ? A MET 3 40 10 Y 1 A GLU 169 ? A GLU 4 41 11 Y 1 A GLY 166 ? A GLY 1 42 11 Y 1 A ALA 167 ? A ALA 2 43 11 Y 1 A MET 168 ? A MET 3 44 11 Y 1 A GLU 169 ? A GLU 4 45 12 Y 1 A GLY 166 ? A GLY 1 46 12 Y 1 A ALA 167 ? A ALA 2 47 12 Y 1 A MET 168 ? A MET 3 48 12 Y 1 A GLU 169 ? A GLU 4 49 13 Y 1 A GLY 166 ? A GLY 1 50 13 Y 1 A ALA 167 ? A ALA 2 51 13 Y 1 A MET 168 ? A MET 3 52 13 Y 1 A GLU 169 ? A GLU 4 53 14 Y 1 A GLY 166 ? A GLY 1 54 14 Y 1 A ALA 167 ? A ALA 2 55 14 Y 1 A MET 168 ? A MET 3 56 14 Y 1 A GLU 169 ? A GLU 4 57 15 Y 1 A GLY 166 ? A GLY 1 58 15 Y 1 A ALA 167 ? A ALA 2 59 15 Y 1 A MET 168 ? A MET 3 60 15 Y 1 A GLU 169 ? A GLU 4 61 16 Y 1 A GLY 166 ? A GLY 1 62 16 Y 1 A ALA 167 ? A ALA 2 63 16 Y 1 A MET 168 ? A MET 3 64 16 Y 1 A GLU 169 ? A GLU 4 65 17 Y 1 A GLY 166 ? A GLY 1 66 17 Y 1 A ALA 167 ? A ALA 2 67 17 Y 1 A MET 168 ? A MET 3 68 17 Y 1 A GLU 169 ? A GLU 4 69 18 Y 1 A GLY 166 ? A GLY 1 70 18 Y 1 A ALA 167 ? A ALA 2 71 18 Y 1 A MET 168 ? A MET 3 72 18 Y 1 A GLU 169 ? A GLU 4 73 19 Y 1 A GLY 166 ? A GLY 1 74 19 Y 1 A ALA 167 ? A ALA 2 75 19 Y 1 A MET 168 ? A MET 3 76 19 Y 1 A GLU 169 ? A GLU 4 77 20 Y 1 A GLY 166 ? A GLY 1 78 20 Y 1 A ALA 167 ? A ALA 2 79 20 Y 1 A MET 168 ? A MET 3 80 20 Y 1 A GLU 169 ? A GLU 4 #