data_2LB1 # _entry.id 2LB1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LB1 pdb_00002lb1 10.2210/pdb2lb1/pdb RCSB RCSB102177 ? ? BMRB 17543 ? 10.13018/BMR17543 WWPDB D_1000102177 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2016-04-27 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' pdbx_nmr_software 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LB1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17543 BMRB unspecified . 2LAW PDB unspecified . 2LAX PDB unspecified . 2LAY PDB unspecified . 2LAZ PDB unspecified . 2LB0 PDB unspecified . 2LB2 PDB unspecified . 2LB3 PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Macias, M.J.' 1 'Aragon, E.' 2 'Goerner, N.' 3 'Zaromytidou, A.' 4 'Xi, Q.' 5 'Escobedo, A.' 6 'Massague, J.' 7 # _citation.id primary _citation.title 'A Smad action turnover switch operated by WW domain readers of a phosphoserine code.' _citation.journal_abbrev 'Genes Dev.' _citation.journal_volume 25 _citation.page_first 1275 _citation.page_last 1288 _citation.year 2011 _citation.journal_id_ASTM GEDEEP _citation.country US _citation.journal_id_ISSN 0890-9369 _citation.journal_id_CSD 2056 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21685363 _citation.pdbx_database_id_DOI 10.1101/gad.2060811 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aragon, E.' 1 ? primary 'Goerner, N.' 2 ? primary 'Zaromytidou, A.I.' 3 ? primary 'Xi, Q.' 4 ? primary 'Escobedo, A.' 5 ? primary 'Massague, J.' 6 ? primary 'Macias, M.J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin-protein ligase SMURF1' 4170.647 1 6.3.2.- ? 'residues 305-339' ? 2 polymer syn 'Mothers against decapentaplegic homolog 1' 1477.592 1 ? ? 'residues 221-233' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'hSMURF1, SMAD ubiquitination regulatory factor 1, SMAD-specific E3 ubiquitin-protein ligase 1' 2 ;MAD homolog 1, Mothers against DPP homolog 1, JV4-1, Mad-related protein 1, SMAD family member 1, SMAD 1, Smad1, hSMAD1, Transforming growth factor-beta-signaling protein 1, BSP-1 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH A ? 2 'polypeptide(L)' no yes 'ADTPPPAYLPPEDP(NH2)' ADTPPPAYLPPEDPX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LEU n 1 2 GLY n 1 3 PRO n 1 4 LEU n 1 5 PRO n 1 6 PRO n 1 7 GLY n 1 8 TRP n 1 9 GLU n 1 10 VAL n 1 11 ARG n 1 12 SER n 1 13 THR n 1 14 VAL n 1 15 SER n 1 16 GLY n 1 17 ARG n 1 18 ILE n 1 19 TYR n 1 20 PHE n 1 21 VAL n 1 22 ASP n 1 23 HIS n 1 24 ASN n 1 25 ASN n 1 26 ARG n 1 27 THR n 1 28 THR n 1 29 GLN n 1 30 PHE n 1 31 THR n 1 32 ASP n 1 33 PRO n 1 34 ARG n 1 35 LEU n 1 36 HIS n 2 1 ALA n 2 2 ASP n 2 3 THR n 2 4 PRO n 2 5 PRO n 2 6 PRO n 2 7 ALA n 2 8 TYR n 2 9 LEU n 2 10 PRO n 2 11 PRO n 2 12 GLU n 2 13 ASP n 2 14 PRO n 2 15 NH2 n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SMURF1, KIAA1625' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pETM11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LEU 1 279 279 LEU LEU A . n A 1 2 GLY 2 280 280 GLY GLY A . n A 1 3 PRO 3 281 281 PRO PRO A . n A 1 4 LEU 4 282 282 LEU LEU A . n A 1 5 PRO 5 283 283 PRO PRO A . n A 1 6 PRO 6 284 284 PRO PRO A . n A 1 7 GLY 7 285 285 GLY GLY A . n A 1 8 TRP 8 286 286 TRP TRP A . n A 1 9 GLU 9 287 287 GLU GLU A . n A 1 10 VAL 10 288 288 VAL VAL A . n A 1 11 ARG 11 289 289 ARG ARG A . n A 1 12 SER 12 290 290 SER SER A . n A 1 13 THR 13 291 291 THR THR A . n A 1 14 VAL 14 292 292 VAL VAL A . n A 1 15 SER 15 293 293 SER SER A . n A 1 16 GLY 16 294 294 GLY GLY A . n A 1 17 ARG 17 295 295 ARG ARG A . n A 1 18 ILE 18 296 296 ILE ILE A . n A 1 19 TYR 19 297 297 TYR TYR A . n A 1 20 PHE 20 298 298 PHE PHE A . n A 1 21 VAL 21 299 299 VAL VAL A . n A 1 22 ASP 22 300 300 ASP ASP A . n A 1 23 HIS 23 301 301 HIS HIS A . n A 1 24 ASN 24 302 302 ASN ASN A . n A 1 25 ASN 25 303 303 ASN ASN A . n A 1 26 ARG 26 304 304 ARG ARG A . n A 1 27 THR 27 305 305 THR THR A . n A 1 28 THR 28 306 306 THR THR A . n A 1 29 GLN 29 307 307 GLN GLN A . n A 1 30 PHE 30 308 308 PHE PHE A . n A 1 31 THR 31 309 309 THR THR A . n A 1 32 ASP 32 310 310 ASP ASP A . n A 1 33 PRO 33 311 311 PRO PRO A . n A 1 34 ARG 34 312 312 ARG ARG A . n A 1 35 LEU 35 313 313 LEU LEU A . n A 1 36 HIS 36 314 ? ? ? A . n B 2 1 ALA 1 220 ? ? ? B . n B 2 2 ASP 2 221 221 ASP ASP B . n B 2 3 THR 3 222 222 THR THR B . n B 2 4 PRO 4 223 223 PRO PRO B . n B 2 5 PRO 5 224 224 PRO PRO B . n B 2 6 PRO 6 225 225 PRO PRO B . n B 2 7 ALA 7 226 226 ALA ALA B . n B 2 8 TYR 8 227 227 TYR TYR B . n B 2 9 LEU 9 228 228 LEU LEU B . n B 2 10 PRO 10 229 229 PRO PRO B . n B 2 11 PRO 11 230 230 PRO PRO B . n B 2 12 GLU 12 231 231 GLU GLU B . n B 2 13 ASP 13 232 232 ASP ASP B . n B 2 14 PRO 14 233 233 PRO PRO B . n B 2 15 NH2 15 234 234 NH2 NH2 B . n # _cell.entry_id 2LB1 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2LB1 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Structure of the first domain of human Smurf1 in complex with a human Smad1 derived peptide.' _exptl.entry_id 2LB1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LB1 _struct.title 'Structure of the second domain of human Smurf1 in complex with a human Smad1 derived peptide' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LB1 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/TRANSCRIPTION' _struct_keywords.text 'SMURF, SMAD, CDK, signal transduction, SIGNALING PROTEIN-TRANSCRIPTION complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP SMUF1_HUMAN Q9HCE7 1 LGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH 305 ? 2 UNP SMAD1_HUMAN Q15797 2 ADTPPPAYLPPEDP 220 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LB1 A 1 ? 36 ? Q9HCE7 305 ? 340 ? 279 314 2 2 2LB1 B 1 ? 14 ? Q15797 220 ? 233 ? 220 233 # _struct_ref_seq_dif.align_id 2 _struct_ref_seq_dif.pdbx_pdb_id_code 2LB1 _struct_ref_seq_dif.mon_id NH2 _struct_ref_seq_dif.pdbx_pdb_strand_id B _struct_ref_seq_dif.seq_num 15 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q15797 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details insertion _struct_ref_seq_dif.pdbx_auth_seq_num 234 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id PRO _struct_conn.ptnr1_label_seq_id 14 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id NH2 _struct_conn.ptnr2_label_seq_id 15 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id PRO _struct_conn.ptnr1_auth_seq_id 233 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id NH2 _struct_conn.ptnr2_auth_seq_id 234 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.322 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NH2 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 15 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id PRO _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 14 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id NH2 _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 234 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id PRO _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 233 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id PRO _pdbx_modification_feature.ref_pcm_id 13 _pdbx_modification_feature.ref_comp_id NH2 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Terminal amidation' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 8 ? THR A 13 ? TRP A 286 THR A 291 A 2 ARG A 17 ? ASP A 22 ? ARG A 295 ASP A 300 A 3 THR A 27 ? GLN A 29 ? THR A 305 GLN A 307 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 9 ? N GLU A 287 O VAL A 21 ? O VAL A 299 A 2 3 N PHE A 20 ? N PHE A 298 O GLN A 29 ? O GLN A 307 # _pdbx_entry_details.entry_id 2LB1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.25 2 4 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.28 3 4 HH21 A ARG 289 ? ? OE1 B GLU 231 ? ? 1.60 4 6 H1 A LEU 279 ? ? O A LEU 313 ? ? 1.59 5 7 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.18 6 7 HH21 A ARG 289 ? ? OE2 B GLU 231 ? ? 1.59 7 8 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.11 8 8 H2 A LEU 279 ? ? O A LEU 313 ? ? 1.55 9 9 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.21 10 9 HH21 A ARG 289 ? ? OE2 B GLU 231 ? ? 1.59 11 11 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.08 12 13 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.11 13 15 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.16 14 16 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.24 15 16 HH21 A ARG 289 ? ? OE1 B GLU 231 ? ? 1.59 16 16 OD2 A ASP 300 ? ? HG1 A THR 305 ? ? 1.60 17 17 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.30 18 18 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.21 19 18 OD2 A ASP 300 ? ? HG1 A THR 305 ? ? 1.57 20 20 HD2 A ARG 289 ? ? HE1 A TYR 297 ? ? 1.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 304 ? ? 65.76 75.24 2 1 PRO B 225 ? ? -57.68 -179.82 3 2 ARG A 304 ? ? 62.15 69.66 4 3 ARG A 304 ? ? 61.28 75.25 5 4 ARG A 304 ? ? 65.41 82.04 6 5 ARG A 304 ? ? 68.54 81.25 7 6 ARG A 304 ? ? 67.12 89.44 8 6 PRO B 223 ? ? -48.50 153.55 9 6 PRO B 225 ? ? -56.48 176.51 10 8 ARG A 304 ? ? 59.01 79.02 11 9 ARG A 304 ? ? 67.59 83.09 12 10 ARG A 304 ? ? 61.28 77.04 13 10 PRO B 225 ? ? -64.80 -179.68 14 11 ARG A 304 ? ? 67.06 81.17 15 11 PRO B 225 ? ? -56.10 171.76 16 12 ARG A 304 ? ? 71.03 53.34 17 12 PRO B 225 ? ? -63.36 -179.96 18 13 ARG A 304 ? ? 64.83 78.17 19 14 ASN A 302 ? ? -91.51 -64.82 20 14 ARG A 304 ? ? 66.99 84.00 21 14 PRO B 225 ? ? -58.58 179.99 22 15 ARG A 304 ? ? 64.72 82.90 23 16 ARG A 304 ? ? 73.76 35.83 24 17 ARG A 304 ? ? 69.46 83.46 25 18 ARG A 304 ? ? 57.31 81.92 26 18 PRO B 225 ? ? -55.74 173.22 27 19 ARG A 304 ? ? 66.38 83.74 28 20 PRO B 225 ? ? -61.20 -179.99 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 PRO B 229 ? ? PRO B 230 ? ? -145.69 2 2 PRO B 229 ? ? PRO B 230 ? ? -137.02 3 3 PRO B 229 ? ? PRO B 230 ? ? -147.71 4 4 PRO B 229 ? ? PRO B 230 ? ? -146.32 5 5 PRO B 229 ? ? PRO B 230 ? ? -143.44 6 6 PRO B 229 ? ? PRO B 230 ? ? -145.73 7 7 PRO B 229 ? ? PRO B 230 ? ? -147.12 8 8 PRO B 229 ? ? PRO B 230 ? ? -143.88 9 9 PRO B 229 ? ? PRO B 230 ? ? -149.62 10 11 PRO B 229 ? ? PRO B 230 ? ? -143.89 11 12 PRO B 229 ? ? PRO B 230 ? ? -145.98 12 13 PRO B 229 ? ? PRO B 230 ? ? -146.52 13 14 PRO B 229 ? ? PRO B 230 ? ? -146.80 14 15 PRO B 229 ? ? PRO B 230 ? ? -146.60 15 16 PRO B 229 ? ? PRO B 230 ? ? -146.52 16 17 PRO B 229 ? ? PRO B 230 ? ? -145.93 17 18 PRO B 229 ? ? PRO B 230 ? ? -149.11 18 19 PRO B 229 ? ? PRO B 230 ? ? -147.62 19 20 PRO B 229 ? ? PRO B 230 ? ? -147.43 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 ARG A 289 ? ? 0.092 'SIDE CHAIN' 2 5 ARG A 289 ? ? 0.074 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LB1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LB1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NEDD4LWW3-1 1 ? mM ? 1 SMAD3-2 3 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 'sodium azide-5' 2 ? mM ? 1 NEDD4LWW3-6 1 ? mM '[U-100% 15N]' 2 SMAD3-7 3 ? mM ? 2 'sodium phosphate-8' 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'sodium azide-10' 2 ? mM ? 2 NEDD4LWW3-11 1 ? mM '[U-100% 13C; U-100% 15N]' 3 SMAD3-12 3 ? mM ? 3 'sodium phosphate-13' 20 ? mM ? 3 'sodium chloride-14' 100 ? mM ? 3 'sodium azide-15' 2 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.420 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 3 '3D CBCA(CO)NH' 1 4 3 '3D HNCACB' 1 5 2 '2D 1H-15N HSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LB1 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 10 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 711 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 308 _pdbx_nmr_constraints.NOE_medium_range_total_count 51 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 171 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LB1 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.3 1 'Bartels et al.' 'chemical shift assignment' XEASY ? 2 'Bruker Biospin' collection TopSpin ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 ? refinement CNS ? 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 314 ? A HIS 36 2 1 Y 1 B ALA 220 ? B ALA 1 3 2 Y 1 A HIS 314 ? A HIS 36 4 2 Y 1 B ALA 220 ? B ALA 1 5 3 Y 1 A HIS 314 ? A HIS 36 6 3 Y 1 B ALA 220 ? B ALA 1 7 4 Y 1 A HIS 314 ? A HIS 36 8 4 Y 1 B ALA 220 ? B ALA 1 9 5 Y 1 A HIS 314 ? A HIS 36 10 5 Y 1 B ALA 220 ? B ALA 1 11 6 Y 1 A HIS 314 ? A HIS 36 12 6 Y 1 B ALA 220 ? B ALA 1 13 7 Y 1 A HIS 314 ? A HIS 36 14 7 Y 1 B ALA 220 ? B ALA 1 15 8 Y 1 A HIS 314 ? A HIS 36 16 8 Y 1 B ALA 220 ? B ALA 1 17 9 Y 1 A HIS 314 ? A HIS 36 18 9 Y 1 B ALA 220 ? B ALA 1 19 10 Y 1 A HIS 314 ? A HIS 36 20 10 Y 1 B ALA 220 ? B ALA 1 21 11 Y 1 A HIS 314 ? A HIS 36 22 11 Y 1 B ALA 220 ? B ALA 1 23 12 Y 1 A HIS 314 ? A HIS 36 24 12 Y 1 B ALA 220 ? B ALA 1 25 13 Y 1 A HIS 314 ? A HIS 36 26 13 Y 1 B ALA 220 ? B ALA 1 27 14 Y 1 A HIS 314 ? A HIS 36 28 14 Y 1 B ALA 220 ? B ALA 1 29 15 Y 1 A HIS 314 ? A HIS 36 30 15 Y 1 B ALA 220 ? B ALA 1 31 16 Y 1 A HIS 314 ? A HIS 36 32 16 Y 1 B ALA 220 ? B ALA 1 33 17 Y 1 A HIS 314 ? A HIS 36 34 17 Y 1 B ALA 220 ? B ALA 1 35 18 Y 1 A HIS 314 ? A HIS 36 36 18 Y 1 B ALA 220 ? B ALA 1 37 19 Y 1 A HIS 314 ? A HIS 36 38 19 Y 1 B ALA 220 ? B ALA 1 39 20 Y 1 A HIS 314 ? A HIS 36 40 20 Y 1 B ALA 220 ? B ALA 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 NH2 N N N N 188 NH2 HN1 H N N 189 NH2 HN2 H N N 190 PHE N N N N 191 PHE CA C N S 192 PHE C C N N 193 PHE O O N N 194 PHE CB C N N 195 PHE CG C Y N 196 PHE CD1 C Y N 197 PHE CD2 C Y N 198 PHE CE1 C Y N 199 PHE CE2 C Y N 200 PHE CZ C Y N 201 PHE OXT O N N 202 PHE H H N N 203 PHE H2 H N N 204 PHE HA H N N 205 PHE HB2 H N N 206 PHE HB3 H N N 207 PHE HD1 H N N 208 PHE HD2 H N N 209 PHE HE1 H N N 210 PHE HE2 H N N 211 PHE HZ H N N 212 PHE HXT H N N 213 PRO N N N N 214 PRO CA C N S 215 PRO C C N N 216 PRO O O N N 217 PRO CB C N N 218 PRO CG C N N 219 PRO CD C N N 220 PRO OXT O N N 221 PRO H H N N 222 PRO HA H N N 223 PRO HB2 H N N 224 PRO HB3 H N N 225 PRO HG2 H N N 226 PRO HG3 H N N 227 PRO HD2 H N N 228 PRO HD3 H N N 229 PRO HXT H N N 230 SER N N N N 231 SER CA C N S 232 SER C C N N 233 SER O O N N 234 SER CB C N N 235 SER OG O N N 236 SER OXT O N N 237 SER H H N N 238 SER H2 H N N 239 SER HA H N N 240 SER HB2 H N N 241 SER HB3 H N N 242 SER HG H N N 243 SER HXT H N N 244 THR N N N N 245 THR CA C N S 246 THR C C N N 247 THR O O N N 248 THR CB C N R 249 THR OG1 O N N 250 THR CG2 C N N 251 THR OXT O N N 252 THR H H N N 253 THR H2 H N N 254 THR HA H N N 255 THR HB H N N 256 THR HG1 H N N 257 THR HG21 H N N 258 THR HG22 H N N 259 THR HG23 H N N 260 THR HXT H N N 261 TRP N N N N 262 TRP CA C N S 263 TRP C C N N 264 TRP O O N N 265 TRP CB C N N 266 TRP CG C Y N 267 TRP CD1 C Y N 268 TRP CD2 C Y N 269 TRP NE1 N Y N 270 TRP CE2 C Y N 271 TRP CE3 C Y N 272 TRP CZ2 C Y N 273 TRP CZ3 C Y N 274 TRP CH2 C Y N 275 TRP OXT O N N 276 TRP H H N N 277 TRP H2 H N N 278 TRP HA H N N 279 TRP HB2 H N N 280 TRP HB3 H N N 281 TRP HD1 H N N 282 TRP HE1 H N N 283 TRP HE3 H N N 284 TRP HZ2 H N N 285 TRP HZ3 H N N 286 TRP HH2 H N N 287 TRP HXT H N N 288 TYR N N N N 289 TYR CA C N S 290 TYR C C N N 291 TYR O O N N 292 TYR CB C N N 293 TYR CG C Y N 294 TYR CD1 C Y N 295 TYR CD2 C Y N 296 TYR CE1 C Y N 297 TYR CE2 C Y N 298 TYR CZ C Y N 299 TYR OH O N N 300 TYR OXT O N N 301 TYR H H N N 302 TYR H2 H N N 303 TYR HA H N N 304 TYR HB2 H N N 305 TYR HB3 H N N 306 TYR HD1 H N N 307 TYR HD2 H N N 308 TYR HE1 H N N 309 TYR HE2 H N N 310 TYR HH H N N 311 TYR HXT H N N 312 VAL N N N N 313 VAL CA C N S 314 VAL C C N N 315 VAL O O N N 316 VAL CB C N N 317 VAL CG1 C N N 318 VAL CG2 C N N 319 VAL OXT O N N 320 VAL H H N N 321 VAL H2 H N N 322 VAL HA H N N 323 VAL HB H N N 324 VAL HG11 H N N 325 VAL HG12 H N N 326 VAL HG13 H N N 327 VAL HG21 H N N 328 VAL HG22 H N N 329 VAL HG23 H N N 330 VAL HXT H N N 331 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 NH2 N HN1 sing N N 179 NH2 N HN2 sing N N 180 PHE N CA sing N N 181 PHE N H sing N N 182 PHE N H2 sing N N 183 PHE CA C sing N N 184 PHE CA CB sing N N 185 PHE CA HA sing N N 186 PHE C O doub N N 187 PHE C OXT sing N N 188 PHE CB CG sing N N 189 PHE CB HB2 sing N N 190 PHE CB HB3 sing N N 191 PHE CG CD1 doub Y N 192 PHE CG CD2 sing Y N 193 PHE CD1 CE1 sing Y N 194 PHE CD1 HD1 sing N N 195 PHE CD2 CE2 doub Y N 196 PHE CD2 HD2 sing N N 197 PHE CE1 CZ doub Y N 198 PHE CE1 HE1 sing N N 199 PHE CE2 CZ sing Y N 200 PHE CE2 HE2 sing N N 201 PHE CZ HZ sing N N 202 PHE OXT HXT sing N N 203 PRO N CA sing N N 204 PRO N CD sing N N 205 PRO N H sing N N 206 PRO CA C sing N N 207 PRO CA CB sing N N 208 PRO CA HA sing N N 209 PRO C O doub N N 210 PRO C OXT sing N N 211 PRO CB CG sing N N 212 PRO CB HB2 sing N N 213 PRO CB HB3 sing N N 214 PRO CG CD sing N N 215 PRO CG HG2 sing N N 216 PRO CG HG3 sing N N 217 PRO CD HD2 sing N N 218 PRO CD HD3 sing N N 219 PRO OXT HXT sing N N 220 SER N CA sing N N 221 SER N H sing N N 222 SER N H2 sing N N 223 SER CA C sing N N 224 SER CA CB sing N N 225 SER CA HA sing N N 226 SER C O doub N N 227 SER C OXT sing N N 228 SER CB OG sing N N 229 SER CB HB2 sing N N 230 SER CB HB3 sing N N 231 SER OG HG sing N N 232 SER OXT HXT sing N N 233 THR N CA sing N N 234 THR N H sing N N 235 THR N H2 sing N N 236 THR CA C sing N N 237 THR CA CB sing N N 238 THR CA HA sing N N 239 THR C O doub N N 240 THR C OXT sing N N 241 THR CB OG1 sing N N 242 THR CB CG2 sing N N 243 THR CB HB sing N N 244 THR OG1 HG1 sing N N 245 THR CG2 HG21 sing N N 246 THR CG2 HG22 sing N N 247 THR CG2 HG23 sing N N 248 THR OXT HXT sing N N 249 TRP N CA sing N N 250 TRP N H sing N N 251 TRP N H2 sing N N 252 TRP CA C sing N N 253 TRP CA CB sing N N 254 TRP CA HA sing N N 255 TRP C O doub N N 256 TRP C OXT sing N N 257 TRP CB CG sing N N 258 TRP CB HB2 sing N N 259 TRP CB HB3 sing N N 260 TRP CG CD1 doub Y N 261 TRP CG CD2 sing Y N 262 TRP CD1 NE1 sing Y N 263 TRP CD1 HD1 sing N N 264 TRP CD2 CE2 doub Y N 265 TRP CD2 CE3 sing Y N 266 TRP NE1 CE2 sing Y N 267 TRP NE1 HE1 sing N N 268 TRP CE2 CZ2 sing Y N 269 TRP CE3 CZ3 doub Y N 270 TRP CE3 HE3 sing N N 271 TRP CZ2 CH2 doub Y N 272 TRP CZ2 HZ2 sing N N 273 TRP CZ3 CH2 sing Y N 274 TRP CZ3 HZ3 sing N N 275 TRP CH2 HH2 sing N N 276 TRP OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2LB1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ #