data_2LB3 # _entry.id 2LB3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LB3 pdb_00002lb3 10.2210/pdb2lb3/pdb RCSB RCSB102179 ? ? BMRB 17545 ? 10.13018/BMR17545 WWPDB D_1000102179 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature 6 3 'Structure model' pdbx_nmr_software 7 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LB3 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-03-22 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17545 BMRB unspecified . 2LAW PDB unspecified . 2LAX PDB unspecified . 2LAY PDB unspecified . 2LAZ PDB unspecified . 2LB0 PDB unspecified . 2LB1 PDB unspecified . 2LB2 PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Macias, M.J.' 1 'Aragon, E.' 2 'Goerner, N.' 3 'Zaromytidou, A.' 4 'Xi, Q.' 5 'Escobedo, A.' 6 'Massague, J.' 7 # _citation.id primary _citation.title 'A Smad action turnover switch operated by WW domain readers of a phosphoserine code.' _citation.journal_abbrev 'Genes Dev.' _citation.journal_volume 25 _citation.page_first 1275 _citation.page_last 1288 _citation.year 2011 _citation.journal_id_ASTM GEDEEP _citation.country US _citation.journal_id_ISSN 0890-9369 _citation.journal_id_CSD 2056 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21685363 _citation.pdbx_database_id_DOI 10.1101/gad.2060811 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aragon, E.' 1 ? primary 'Goerner, N.' 2 ? primary 'Zaromytidou, A.I.' 3 ? primary 'Xi, Q.' 4 ? primary 'Escobedo, A.' 5 ? primary 'Massague, J.' 6 ? primary 'Macias, M.J.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1' 4231.692 1 5.2.1.8 ? 'residues 6-41' ? 2 polymer syn 'Mothers against decapentaplegic homolog 2' 886.882 1 ? ? 'residues 176-183' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Peptidyl-prolyl cis-trans isomerase Pin1, PPIase Pin1, Rotamase Pin1' 2 'MAD homolog 2, Mothers against DPP homolog 2, JV18-1, Mad-related protein 2, hMAD-2, SMAD family member 2, SMAD 2, Smad2, hSMAD2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS A ? 2 'polypeptide(L)' no yes 'IPE(TPO)PPPG' IPETPPPG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 LEU n 1 3 PRO n 1 4 PRO n 1 5 GLY n 1 6 TRP n 1 7 GLU n 1 8 LYS n 1 9 ARG n 1 10 MET n 1 11 SER n 1 12 ARG n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 ARG n 1 17 VAL n 1 18 TYR n 1 19 TYR n 1 20 PHE n 1 21 ASN n 1 22 HIS n 1 23 ILE n 1 24 THR n 1 25 ASN n 1 26 ALA n 1 27 SER n 1 28 GLN n 1 29 TRP n 1 30 GLU n 1 31 ARG n 1 32 PRO n 1 33 SER n 1 34 GLY n 1 35 ASN n 1 36 SER n 2 1 ILE n 2 2 PRO n 2 3 GLU n 2 4 TPO n 2 5 PRO n 2 6 PRO n 2 7 PRO n 2 8 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PIN1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pETM11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 10 10 LYS LYS A . n A 1 2 LEU 2 11 11 LEU LEU A . n A 1 3 PRO 3 12 12 PRO PRO A . n A 1 4 PRO 4 13 13 PRO PRO A . n A 1 5 GLY 5 14 14 GLY GLY A . n A 1 6 TRP 6 15 15 TRP TRP A . n A 1 7 GLU 7 16 16 GLU GLU A . n A 1 8 LYS 8 17 17 LYS LYS A . n A 1 9 ARG 9 18 18 ARG ARG A . n A 1 10 MET 10 19 19 MET MET A . n A 1 11 SER 11 20 20 SER SER A . n A 1 12 ARG 12 21 21 ARG ARG A . n A 1 13 SER 13 22 22 SER SER A . n A 1 14 SER 14 23 23 SER SER A . n A 1 15 GLY 15 24 24 GLY GLY A . n A 1 16 ARG 16 25 25 ARG ARG A . n A 1 17 VAL 17 26 26 VAL VAL A . n A 1 18 TYR 18 27 27 TYR TYR A . n A 1 19 TYR 19 28 28 TYR TYR A . n A 1 20 PHE 20 29 29 PHE PHE A . n A 1 21 ASN 21 30 30 ASN ASN A . n A 1 22 HIS 22 31 31 HIS HIS A . n A 1 23 ILE 23 32 32 ILE ILE A . n A 1 24 THR 24 33 33 THR THR A . n A 1 25 ASN 25 34 34 ASN ASN A . n A 1 26 ALA 26 35 35 ALA ALA A . n A 1 27 SER 27 36 36 SER SER A . n A 1 28 GLN 28 37 37 GLN GLN A . n A 1 29 TRP 29 38 38 TRP TRP A . n A 1 30 GLU 30 39 39 GLU GLU A . n A 1 31 ARG 31 40 40 ARG ARG A . n A 1 32 PRO 32 41 41 PRO PRO A . n A 1 33 SER 33 42 42 SER SER A . n A 1 34 GLY 34 43 43 GLY GLY A . n A 1 35 ASN 35 44 44 ASN ASN A . n A 1 36 SER 36 45 45 SER SER A . n B 2 1 ILE 1 176 176 ILE ILE B . n B 2 2 PRO 2 177 177 PRO PRO B . n B 2 3 GLU 3 178 178 GLU GLU B . n B 2 4 TPO 4 179 179 TPO TPO B . n B 2 5 PRO 5 180 180 PRO PRO B . n B 2 6 PRO 6 181 181 PRO PRO B . n B 2 7 PRO 7 182 182 PRO PRO B . n B 2 8 GLY 8 183 183 GLY GLY B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Structure of the first domain of human PIN1 in complex with a human Smad3 derived peptide( resi 173-186).' _exptl.entry_id 2LB3 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LB3 _struct.title 'Structure of the WW domain of PIN1 in complex with a human phosphorylated Smad3 derived peptide' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LB3 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/TRANSCRIPTION' _struct_keywords.text 'PIN1, SMAD, CDK, signal transduction, SIGNALING PROTEIN-TRANSCRIPTION complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP PIN1_HUMAN Q13526 1 KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS 6 ? 2 UNP SMAD2_HUMAN Q15796 2 IPETPPPG 217 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2LB3 A 1 ? 36 ? Q13526 6 ? 41 ? 10 45 2 2 2LB3 B 1 ? 8 ? Q15796 217 ? 224 ? 176 183 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B GLU 3 C ? ? ? 1_555 B TPO 4 N ? ? B GLU 178 B TPO 179 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale2 covale both ? B TPO 4 C ? ? ? 1_555 B PRO 5 N ? ? B TPO 179 B PRO 180 1_555 ? ? ? ? ? ? ? 1.358 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id TPO _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id 4 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id TPO _pdbx_modification_feature.auth_asym_id B _pdbx_modification_feature.auth_seq_id 179 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id THR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id TPO _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 8 ? SER A 11 ? LYS A 17 SER A 20 A 2 ARG A 16 ? ASN A 21 ? ARG A 25 ASN A 30 A 3 ALA A 26 ? GLN A 28 ? ALA A 35 GLN A 37 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 11 ? N SER A 20 O ARG A 16 ? O ARG A 25 A 2 3 N ASN A 21 ? N ASN A 30 O ALA A 26 ? O ALA A 35 # _pdbx_entry_details.entry_id 2LB3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.34 2 1 HH A TYR 27 ? ? O B PRO 177 ? ? 1.47 3 2 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.26 4 2 HB3 A ARG 18 ? ? HH A TYR 27 ? ? 1.33 5 3 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.28 6 3 HH A TYR 27 ? ? O B PRO 177 ? ? 1.48 7 4 HB B ILE 176 ? ? HD3 B PRO 177 ? ? 1.24 8 4 HG3 A ARG 25 ? ? HE3 A TRP 38 ? ? 1.34 9 5 HB3 A GLU 16 ? ? HD1 A PHE 29 ? ? 1.30 10 6 HB3 A ARG 18 ? ? HH A TYR 27 ? ? 1.30 11 7 HB3 A GLU 16 ? ? HB3 A PHE 29 ? ? 1.10 12 7 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.27 13 7 HH A TYR 27 ? ? O B PRO 177 ? ? 1.51 14 7 HE A ARG 21 ? ? O2P B TPO 179 ? ? 1.58 15 8 HB B ILE 176 ? ? HD3 B PRO 177 ? ? 1.25 16 8 HH A TYR 27 ? ? O B PRO 177 ? ? 1.49 17 9 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.27 18 9 HH A TYR 27 ? ? O B PRO 177 ? ? 1.52 19 10 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.27 20 10 HH A TYR 27 ? ? O B PRO 177 ? ? 1.51 21 11 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.18 22 13 HB2 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.13 23 14 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.30 24 14 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.34 25 14 HG A SER 22 ? ? O2P B TPO 179 ? ? 1.57 26 15 HB3 A ARG 18 ? ? HH A TYR 27 ? ? 1.33 27 15 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.34 28 16 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.19 29 16 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.25 30 16 HH A TYR 27 ? ? O B PRO 177 ? ? 1.50 31 17 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.25 32 17 HH A TYR 27 ? ? O B PRO 177 ? ? 1.49 33 18 HH A TYR 27 ? ? O B PRO 177 ? ? 1.53 34 18 HG A SER 22 ? ? O2P B TPO 179 ? ? 1.58 35 19 HB3 A GLU 16 ? ? HB3 A PHE 29 ? ? 1.07 36 19 HG3 A ARG 18 ? ? HE2 A TYR 27 ? ? 1.19 37 19 HB3 A ARG 18 ? ? HH A TYR 27 ? ? 1.30 38 19 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.35 39 20 HH2 A TRP 38 ? ? HA B PRO 181 ? ? 1.03 40 20 HH A TYR 27 ? ? O B PRO 177 ? ? 1.50 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 13 ? ? -58.90 -3.53 2 1 SER A 22 ? ? -73.04 -89.79 3 1 ASN A 34 ? ? 69.50 83.50 4 1 TRP A 38 ? ? -49.48 -7.95 5 1 TPO B 179 ? ? 62.44 72.47 6 2 LEU A 11 ? ? 63.14 177.74 7 2 PRO A 13 ? ? -68.49 0.20 8 2 SER A 22 ? ? -73.18 -84.54 9 2 ASN A 34 ? ? 68.84 77.71 10 2 ASN A 44 ? ? -154.02 6.69 11 2 TPO B 179 ? ? 63.90 72.54 12 2 PRO B 181 ? ? -39.08 142.72 13 3 PRO A 13 ? ? -56.23 30.07 14 3 SER A 22 ? ? -79.82 -78.88 15 3 ASN A 34 ? ? 68.00 78.12 16 3 PRO A 41 ? ? -76.47 -70.18 17 3 SER A 42 ? ? -130.07 -66.36 18 3 TPO B 179 ? ? 70.25 72.90 19 4 SER A 22 ? ? -66.49 -78.43 20 4 ASN A 34 ? ? 62.62 73.92 21 4 TPO B 179 ? ? 62.80 72.62 22 4 PRO B 181 ? ? -35.22 133.72 23 5 SER A 22 ? ? -70.94 -89.67 24 5 ASN A 34 ? ? 66.61 71.11 25 5 TRP A 38 ? ? -39.39 -7.96 26 5 TPO B 179 ? ? 85.86 73.14 27 6 LEU A 11 ? ? 65.30 175.97 28 6 SER A 22 ? ? -67.35 -73.82 29 6 ASN A 34 ? ? 71.31 75.34 30 6 TPO B 179 ? ? 65.02 72.79 31 7 PRO A 13 ? ? -67.94 0.77 32 7 SER A 22 ? ? -88.07 -86.98 33 7 ASN A 34 ? ? 63.84 64.24 34 7 TRP A 38 ? ? -46.62 -8.31 35 7 TPO B 179 ? ? 75.08 73.01 36 8 ASN A 34 ? ? 64.21 77.21 37 8 TPO B 179 ? ? 73.17 72.25 38 8 PRO B 182 ? ? -75.32 -88.26 39 9 ASN A 34 ? ? 66.15 77.31 40 9 TRP A 38 ? ? -59.75 -8.32 41 9 ASN A 44 ? ? -165.69 -34.22 42 9 TPO B 179 ? ? 60.94 72.11 43 9 PRO B 182 ? ? -25.17 108.93 44 10 SER A 22 ? ? -69.66 -78.18 45 10 ASN A 34 ? ? 69.33 73.52 46 10 TRP A 38 ? ? -40.32 -7.90 47 10 TPO B 179 ? ? 62.29 72.83 48 11 ASN A 34 ? ? 62.45 82.08 49 11 ASN A 44 ? ? -147.18 17.72 50 11 TPO B 179 ? ? 62.49 72.51 51 12 SER A 22 ? ? -67.27 -84.18 52 12 ASN A 34 ? ? 70.08 38.09 53 12 TRP A 38 ? ? -41.60 -8.13 54 12 TPO B 179 ? ? 66.87 73.04 55 13 TRP A 38 ? ? -41.93 -7.83 56 13 ASN A 44 ? ? 65.11 -87.06 57 13 TPO B 179 ? ? 71.69 72.47 58 14 PRO A 13 ? ? -68.47 4.54 59 14 ILE A 32 ? ? -79.83 -70.03 60 14 ASN A 34 ? ? 70.16 88.36 61 14 TPO B 179 ? ? 62.47 72.79 62 14 PRO B 181 ? ? -39.25 136.72 63 15 PRO A 13 ? ? -68.54 8.83 64 15 SER A 22 ? ? -82.71 -70.07 65 15 ASN A 34 ? ? 62.36 81.48 66 15 TRP A 38 ? ? -38.08 -8.07 67 15 TPO B 179 ? ? 75.06 72.76 68 16 SER A 22 ? ? -77.96 -86.47 69 16 TRP A 38 ? ? -58.12 -8.02 70 16 TPO B 179 ? ? 57.09 72.74 71 17 ASN A 34 ? ? 69.98 82.21 72 17 TRP A 38 ? ? -58.22 -7.93 73 17 ASN A 44 ? ? 72.55 -43.72 74 17 TPO B 179 ? ? 62.76 72.61 75 18 ASN A 34 ? ? 67.60 79.12 76 18 TPO B 179 ? ? 63.30 72.68 77 19 LEU A 11 ? ? 84.39 6.88 78 19 PRO A 13 ? ? -57.97 -7.28 79 19 SER A 22 ? ? -80.29 -72.82 80 19 ASN A 34 ? ? 72.46 86.86 81 19 TPO B 179 ? ? 62.59 72.67 82 20 SER A 22 ? ? -74.23 -82.77 83 20 ASN A 34 ? ? 68.73 84.47 84 20 TPO B 179 ? ? 74.48 72.83 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 TRP A 38 ? ? GLU A 39 ? ? -147.53 2 1 PRO B 180 ? ? PRO B 181 ? ? -148.90 3 2 TRP A 38 ? ? GLU A 39 ? ? -147.91 4 2 PRO B 180 ? ? PRO B 181 ? ? -149.21 5 3 TRP A 38 ? ? GLU A 39 ? ? -148.56 6 4 PRO B 180 ? ? PRO B 181 ? ? -148.17 7 5 PRO B 180 ? ? PRO B 181 ? ? -148.63 8 7 TRP A 38 ? ? GLU A 39 ? ? -147.60 9 9 PRO B 180 ? ? PRO B 181 ? ? -149.62 10 11 TRP A 38 ? ? GLU A 39 ? ? -149.55 11 12 TRP A 38 ? ? GLU A 39 ? ? -149.95 12 12 PRO B 180 ? ? PRO B 181 ? ? -149.55 13 13 PRO B 180 ? ? PRO B 181 ? ? -150.00 14 15 PRO B 177 ? ? GLU B 178 ? ? 149.76 15 16 TRP A 38 ? ? GLU A 39 ? ? -149.96 16 16 PRO B 180 ? ? PRO B 181 ? ? -148.66 17 17 TRP A 38 ? ? GLU A 39 ? ? -146.57 18 18 TRP A 38 ? ? GLU A 39 ? ? -149.71 19 19 TRP A 38 ? ? GLU A 39 ? ? -146.92 20 19 PRO B 177 ? ? GLU B 178 ? ? 148.53 21 19 PRO B 180 ? ? PRO B 181 ? ? -149.81 22 20 PRO B 180 ? ? PRO B 181 ? ? -148.40 # loop_ _pdbx_validate_main_chain_plane.id _pdbx_validate_main_chain_plane.PDB_model_num _pdbx_validate_main_chain_plane.auth_comp_id _pdbx_validate_main_chain_plane.auth_asym_id _pdbx_validate_main_chain_plane.auth_seq_id _pdbx_validate_main_chain_plane.PDB_ins_code _pdbx_validate_main_chain_plane.label_alt_id _pdbx_validate_main_chain_plane.improper_torsion_angle 1 4 GLU A 39 ? ? 11.31 2 9 GLU A 39 ? ? 10.40 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 179 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details PHOSPHOTHREONINE # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with acceptable covalent geometry' _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LB3 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LB3 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] NEDD4LWW3, 3 mM SMAD3, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id NEDD4LWW3-1 1 ? mM ? 1 SMAD3-2 3 ? mM ? 1 'sodium phosphate-3' 20 ? mM ? 1 'sodium chloride-4' 100 ? mM ? 1 'sodium azide-5' 2 ? mM ? 1 NEDD4LWW3-6 1 ? mM '[U-100% 15N]' 2 SMAD3-7 3 ? mM ? 2 'sodium phosphate-8' 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 'sodium azide-10' 2 ? mM ? 2 NEDD4LWW3-11 1 ? mM '[U-100% 13C; U-100% 15N]' 3 SMAD3-12 3 ? mM ? 3 'sodium phosphate-13' 20 ? mM ? 3 'sodium chloride-14' 100 ? mM ? 3 'sodium azide-15' 2 ? mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.420 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 285 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 3 '3D CBCA(CO)NH' 1 4 3 '3D HNCACB' 1 5 2 '2D 1H-15N HSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LB3 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 10 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 557 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 215 _pdbx_nmr_constraints.NOE_medium_range_total_count 56 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 167 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2LB3 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.3 1 'Bartels et al.' 'chemical shift assignment' XEASY ? 2 'Bruker Biospin' collection TopSpin ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 ? refinement CNS ? 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 HIS N N N N 107 HIS CA C N S 108 HIS C C N N 109 HIS O O N N 110 HIS CB C N N 111 HIS CG C Y N 112 HIS ND1 N Y N 113 HIS CD2 C Y N 114 HIS CE1 C Y N 115 HIS NE2 N Y N 116 HIS OXT O N N 117 HIS H H N N 118 HIS H2 H N N 119 HIS HA H N N 120 HIS HB2 H N N 121 HIS HB3 H N N 122 HIS HD1 H N N 123 HIS HD2 H N N 124 HIS HE1 H N N 125 HIS HE2 H N N 126 HIS HXT H N N 127 ILE N N N N 128 ILE CA C N S 129 ILE C C N N 130 ILE O O N N 131 ILE CB C N S 132 ILE CG1 C N N 133 ILE CG2 C N N 134 ILE CD1 C N N 135 ILE OXT O N N 136 ILE H H N N 137 ILE H2 H N N 138 ILE HA H N N 139 ILE HB H N N 140 ILE HG12 H N N 141 ILE HG13 H N N 142 ILE HG21 H N N 143 ILE HG22 H N N 144 ILE HG23 H N N 145 ILE HD11 H N N 146 ILE HD12 H N N 147 ILE HD13 H N N 148 ILE HXT H N N 149 LEU N N N N 150 LEU CA C N S 151 LEU C C N N 152 LEU O O N N 153 LEU CB C N N 154 LEU CG C N N 155 LEU CD1 C N N 156 LEU CD2 C N N 157 LEU OXT O N N 158 LEU H H N N 159 LEU H2 H N N 160 LEU HA H N N 161 LEU HB2 H N N 162 LEU HB3 H N N 163 LEU HG H N N 164 LEU HD11 H N N 165 LEU HD12 H N N 166 LEU HD13 H N N 167 LEU HD21 H N N 168 LEU HD22 H N N 169 LEU HD23 H N N 170 LEU HXT H N N 171 LYS N N N N 172 LYS CA C N S 173 LYS C C N N 174 LYS O O N N 175 LYS CB C N N 176 LYS CG C N N 177 LYS CD C N N 178 LYS CE C N N 179 LYS NZ N N N 180 LYS OXT O N N 181 LYS H H N N 182 LYS H2 H N N 183 LYS HA H N N 184 LYS HB2 H N N 185 LYS HB3 H N N 186 LYS HG2 H N N 187 LYS HG3 H N N 188 LYS HD2 H N N 189 LYS HD3 H N N 190 LYS HE2 H N N 191 LYS HE3 H N N 192 LYS HZ1 H N N 193 LYS HZ2 H N N 194 LYS HZ3 H N N 195 LYS HXT H N N 196 MET N N N N 197 MET CA C N S 198 MET C C N N 199 MET O O N N 200 MET CB C N N 201 MET CG C N N 202 MET SD S N N 203 MET CE C N N 204 MET OXT O N N 205 MET H H N N 206 MET H2 H N N 207 MET HA H N N 208 MET HB2 H N N 209 MET HB3 H N N 210 MET HG2 H N N 211 MET HG3 H N N 212 MET HE1 H N N 213 MET HE2 H N N 214 MET HE3 H N N 215 MET HXT H N N 216 PHE N N N N 217 PHE CA C N S 218 PHE C C N N 219 PHE O O N N 220 PHE CB C N N 221 PHE CG C Y N 222 PHE CD1 C Y N 223 PHE CD2 C Y N 224 PHE CE1 C Y N 225 PHE CE2 C Y N 226 PHE CZ C Y N 227 PHE OXT O N N 228 PHE H H N N 229 PHE H2 H N N 230 PHE HA H N N 231 PHE HB2 H N N 232 PHE HB3 H N N 233 PHE HD1 H N N 234 PHE HD2 H N N 235 PHE HE1 H N N 236 PHE HE2 H N N 237 PHE HZ H N N 238 PHE HXT H N N 239 PRO N N N N 240 PRO CA C N S 241 PRO C C N N 242 PRO O O N N 243 PRO CB C N N 244 PRO CG C N N 245 PRO CD C N N 246 PRO OXT O N N 247 PRO H H N N 248 PRO HA H N N 249 PRO HB2 H N N 250 PRO HB3 H N N 251 PRO HG2 H N N 252 PRO HG3 H N N 253 PRO HD2 H N N 254 PRO HD3 H N N 255 PRO HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TPO N N N N 288 TPO CA C N S 289 TPO CB C N R 290 TPO CG2 C N N 291 TPO OG1 O N N 292 TPO P P N N 293 TPO O1P O N N 294 TPO O2P O N N 295 TPO O3P O N N 296 TPO C C N N 297 TPO O O N N 298 TPO OXT O N N 299 TPO H H N N 300 TPO H2 H N N 301 TPO HA H N N 302 TPO HB H N N 303 TPO HG21 H N N 304 TPO HG22 H N N 305 TPO HG23 H N N 306 TPO HOP2 H N N 307 TPO HOP3 H N N 308 TPO HXT H N N 309 TRP N N N N 310 TRP CA C N S 311 TRP C C N N 312 TRP O O N N 313 TRP CB C N N 314 TRP CG C Y N 315 TRP CD1 C Y N 316 TRP CD2 C Y N 317 TRP NE1 N Y N 318 TRP CE2 C Y N 319 TRP CE3 C Y N 320 TRP CZ2 C Y N 321 TRP CZ3 C Y N 322 TRP CH2 C Y N 323 TRP OXT O N N 324 TRP H H N N 325 TRP H2 H N N 326 TRP HA H N N 327 TRP HB2 H N N 328 TRP HB3 H N N 329 TRP HD1 H N N 330 TRP HE1 H N N 331 TRP HE3 H N N 332 TRP HZ2 H N N 333 TRP HZ3 H N N 334 TRP HH2 H N N 335 TRP HXT H N N 336 TYR N N N N 337 TYR CA C N S 338 TYR C C N N 339 TYR O O N N 340 TYR CB C N N 341 TYR CG C Y N 342 TYR CD1 C Y N 343 TYR CD2 C Y N 344 TYR CE1 C Y N 345 TYR CE2 C Y N 346 TYR CZ C Y N 347 TYR OH O N N 348 TYR OXT O N N 349 TYR H H N N 350 TYR H2 H N N 351 TYR HA H N N 352 TYR HB2 H N N 353 TYR HB3 H N N 354 TYR HD1 H N N 355 TYR HD2 H N N 356 TYR HE1 H N N 357 TYR HE2 H N N 358 TYR HH H N N 359 TYR HXT H N N 360 VAL N N N N 361 VAL CA C N S 362 VAL C C N N 363 VAL O O N N 364 VAL CB C N N 365 VAL CG1 C N N 366 VAL CG2 C N N 367 VAL OXT O N N 368 VAL H H N N 369 VAL H2 H N N 370 VAL HA H N N 371 VAL HB H N N 372 VAL HG11 H N N 373 VAL HG12 H N N 374 VAL HG13 H N N 375 VAL HG21 H N N 376 VAL HG22 H N N 377 VAL HG23 H N N 378 VAL HXT H N N 379 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 HIS N CA sing N N 101 HIS N H sing N N 102 HIS N H2 sing N N 103 HIS CA C sing N N 104 HIS CA CB sing N N 105 HIS CA HA sing N N 106 HIS C O doub N N 107 HIS C OXT sing N N 108 HIS CB CG sing N N 109 HIS CB HB2 sing N N 110 HIS CB HB3 sing N N 111 HIS CG ND1 sing Y N 112 HIS CG CD2 doub Y N 113 HIS ND1 CE1 doub Y N 114 HIS ND1 HD1 sing N N 115 HIS CD2 NE2 sing Y N 116 HIS CD2 HD2 sing N N 117 HIS CE1 NE2 sing Y N 118 HIS CE1 HE1 sing N N 119 HIS NE2 HE2 sing N N 120 HIS OXT HXT sing N N 121 ILE N CA sing N N 122 ILE N H sing N N 123 ILE N H2 sing N N 124 ILE CA C sing N N 125 ILE CA CB sing N N 126 ILE CA HA sing N N 127 ILE C O doub N N 128 ILE C OXT sing N N 129 ILE CB CG1 sing N N 130 ILE CB CG2 sing N N 131 ILE CB HB sing N N 132 ILE CG1 CD1 sing N N 133 ILE CG1 HG12 sing N N 134 ILE CG1 HG13 sing N N 135 ILE CG2 HG21 sing N N 136 ILE CG2 HG22 sing N N 137 ILE CG2 HG23 sing N N 138 ILE CD1 HD11 sing N N 139 ILE CD1 HD12 sing N N 140 ILE CD1 HD13 sing N N 141 ILE OXT HXT sing N N 142 LEU N CA sing N N 143 LEU N H sing N N 144 LEU N H2 sing N N 145 LEU CA C sing N N 146 LEU CA CB sing N N 147 LEU CA HA sing N N 148 LEU C O doub N N 149 LEU C OXT sing N N 150 LEU CB CG sing N N 151 LEU CB HB2 sing N N 152 LEU CB HB3 sing N N 153 LEU CG CD1 sing N N 154 LEU CG CD2 sing N N 155 LEU CG HG sing N N 156 LEU CD1 HD11 sing N N 157 LEU CD1 HD12 sing N N 158 LEU CD1 HD13 sing N N 159 LEU CD2 HD21 sing N N 160 LEU CD2 HD22 sing N N 161 LEU CD2 HD23 sing N N 162 LEU OXT HXT sing N N 163 LYS N CA sing N N 164 LYS N H sing N N 165 LYS N H2 sing N N 166 LYS CA C sing N N 167 LYS CA CB sing N N 168 LYS CA HA sing N N 169 LYS C O doub N N 170 LYS C OXT sing N N 171 LYS CB CG sing N N 172 LYS CB HB2 sing N N 173 LYS CB HB3 sing N N 174 LYS CG CD sing N N 175 LYS CG HG2 sing N N 176 LYS CG HG3 sing N N 177 LYS CD CE sing N N 178 LYS CD HD2 sing N N 179 LYS CD HD3 sing N N 180 LYS CE NZ sing N N 181 LYS CE HE2 sing N N 182 LYS CE HE3 sing N N 183 LYS NZ HZ1 sing N N 184 LYS NZ HZ2 sing N N 185 LYS NZ HZ3 sing N N 186 LYS OXT HXT sing N N 187 MET N CA sing N N 188 MET N H sing N N 189 MET N H2 sing N N 190 MET CA C sing N N 191 MET CA CB sing N N 192 MET CA HA sing N N 193 MET C O doub N N 194 MET C OXT sing N N 195 MET CB CG sing N N 196 MET CB HB2 sing N N 197 MET CB HB3 sing N N 198 MET CG SD sing N N 199 MET CG HG2 sing N N 200 MET CG HG3 sing N N 201 MET SD CE sing N N 202 MET CE HE1 sing N N 203 MET CE HE2 sing N N 204 MET CE HE3 sing N N 205 MET OXT HXT sing N N 206 PHE N CA sing N N 207 PHE N H sing N N 208 PHE N H2 sing N N 209 PHE CA C sing N N 210 PHE CA CB sing N N 211 PHE CA HA sing N N 212 PHE C O doub N N 213 PHE C OXT sing N N 214 PHE CB CG sing N N 215 PHE CB HB2 sing N N 216 PHE CB HB3 sing N N 217 PHE CG CD1 doub Y N 218 PHE CG CD2 sing Y N 219 PHE CD1 CE1 sing Y N 220 PHE CD1 HD1 sing N N 221 PHE CD2 CE2 doub Y N 222 PHE CD2 HD2 sing N N 223 PHE CE1 CZ doub Y N 224 PHE CE1 HE1 sing N N 225 PHE CE2 CZ sing Y N 226 PHE CE2 HE2 sing N N 227 PHE CZ HZ sing N N 228 PHE OXT HXT sing N N 229 PRO N CA sing N N 230 PRO N CD sing N N 231 PRO N H sing N N 232 PRO CA C sing N N 233 PRO CA CB sing N N 234 PRO CA HA sing N N 235 PRO C O doub N N 236 PRO C OXT sing N N 237 PRO CB CG sing N N 238 PRO CB HB2 sing N N 239 PRO CB HB3 sing N N 240 PRO CG CD sing N N 241 PRO CG HG2 sing N N 242 PRO CG HG3 sing N N 243 PRO CD HD2 sing N N 244 PRO CD HD3 sing N N 245 PRO OXT HXT sing N N 246 SER N CA sing N N 247 SER N H sing N N 248 SER N H2 sing N N 249 SER CA C sing N N 250 SER CA CB sing N N 251 SER CA HA sing N N 252 SER C O doub N N 253 SER C OXT sing N N 254 SER CB OG sing N N 255 SER CB HB2 sing N N 256 SER CB HB3 sing N N 257 SER OG HG sing N N 258 SER OXT HXT sing N N 259 THR N CA sing N N 260 THR N H sing N N 261 THR N H2 sing N N 262 THR CA C sing N N 263 THR CA CB sing N N 264 THR CA HA sing N N 265 THR C O doub N N 266 THR C OXT sing N N 267 THR CB OG1 sing N N 268 THR CB CG2 sing N N 269 THR CB HB sing N N 270 THR OG1 HG1 sing N N 271 THR CG2 HG21 sing N N 272 THR CG2 HG22 sing N N 273 THR CG2 HG23 sing N N 274 THR OXT HXT sing N N 275 TPO N CA sing N N 276 TPO N H sing N N 277 TPO N H2 sing N N 278 TPO CA CB sing N N 279 TPO CA C sing N N 280 TPO CA HA sing N N 281 TPO CB CG2 sing N N 282 TPO CB OG1 sing N N 283 TPO CB HB sing N N 284 TPO CG2 HG21 sing N N 285 TPO CG2 HG22 sing N N 286 TPO CG2 HG23 sing N N 287 TPO OG1 P sing N N 288 TPO P O1P doub N N 289 TPO P O2P sing N N 290 TPO P O3P sing N N 291 TPO O2P HOP2 sing N N 292 TPO O3P HOP3 sing N N 293 TPO C O doub N N 294 TPO C OXT sing N N 295 TPO OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2LB3 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_