data_2LBN # _entry.id 2LBN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LBN pdb_00002lbn 10.2210/pdb2lbn/pdb RCSB RCSB102198 ? ? BMRB 17571 ? ? WWPDB D_1000102198 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17571 BMRB unspecified . 2LBH PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LBN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, H.' 1 'Nguyen, T.' 2 'Bracken, C.' 3 'Breslow, E.' 4 # _citation.id primary _citation.title ;Structural Basis of the Dimerization-Induced Increase in Neurophysin-Hormone Affinity: Interplay of Inter-Domain and Inter-Subunit Interactions ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, H.' 1 ? primary 'Naik, M.' 2 ? primary 'Bracken, C.' 3 ? primary 'Breslow, E.' 4 ? # _cell.entry_id 2LBN _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2LBN _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Neurophysin 1' _entity.formula_weight 9286.441 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCE EDPACDPEAAFS ; _entity_poly.pdbx_seq_one_letter_code_can ;AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCE EDPACDPEAAFS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 VAL n 1 3 LEU n 1 4 ASP n 1 5 LEU n 1 6 ASP n 1 7 VAL n 1 8 ARG n 1 9 THR n 1 10 CYS n 1 11 LEU n 1 12 PRO n 1 13 CYS n 1 14 GLY n 1 15 PRO n 1 16 GLY n 1 17 GLY n 1 18 LYS n 1 19 GLY n 1 20 ARG n 1 21 CYS n 1 22 PHE n 1 23 GLY n 1 24 PRO n 1 25 SER n 1 26 ILE n 1 27 CYS n 1 28 CYS n 1 29 GLY n 1 30 ASP n 1 31 GLU n 1 32 LEU n 1 33 GLY n 1 34 CYS n 1 35 PHE n 1 36 VAL n 1 37 GLY n 1 38 THR n 1 39 ALA n 1 40 GLU n 1 41 ALA n 1 42 LEU n 1 43 ARG n 1 44 CYS n 1 45 GLN n 1 46 GLU n 1 47 GLU n 1 48 ASN n 1 49 TYR n 1 50 LEU n 1 51 PRO n 1 52 SER n 1 53 PRO n 1 54 CYS n 1 55 GLN n 1 56 SER n 1 57 GLY n 1 58 GLN n 1 59 LYS n 1 60 PRO n 1 61 CYS n 1 62 GLY n 1 63 SER n 1 64 GLY n 1 65 GLY n 1 66 ARG n 1 67 CYS n 1 68 ALA n 1 69 ALA n 1 70 ALA n 1 71 GLY n 1 72 ILE n 1 73 CYS n 1 74 CYS n 1 75 SER n 1 76 PRO n 1 77 ASP n 1 78 GLY n 1 79 CYS n 1 80 GLU n 1 81 GLU n 1 82 ASP n 1 83 PRO n 1 84 ALA n 1 85 CYS n 1 86 ASP n 1 87 PRO n 1 88 GLU n 1 89 ALA n 1 90 ALA n 1 91 PHE n 1 92 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'bovine,cow,domestic cattle,domestic cow' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene OXT _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21(de)plys S' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector T7 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NEU1_BOVIN _struct_ref.pdbx_db_accession P01175 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCH EDPACDPEAAFS ; _struct_ref.pdbx_align_begin 32 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LBN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 92 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01175 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 92 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2LBN _struct_ref_seq_dif.mon_id GLU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 80 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P01175 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 111 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 80 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '3D 1H-15N NOESY' 2 2 2 '3D 1H-15N NOESY' 3 3 2 '3D HNHA' 1 4 2 '3D 1H-13C NOESY' 3 5 2 '3D 1H-13C NOESY' 3 6 2 '2D 1H-15N HSQC' 3 7 2 '2D 1H-15N HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 0 7.5 ambient ? 283 K 2 0 7.5 ambient ? 298 K 3 0 7.5 ambient ? 303 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.4 mM [U-100% 15N] protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.4 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2LBN _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 21 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LBN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LBN _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNSSOLVE 1.0 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 3 'Johnson, One Moon Scientific' 'data analysis' NMRView ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LBN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LBN _struct.title '(Revised) Solution structure of the monomeric form of a mutant unliganded bovine neurophysin, 20 structures' _struct.pdbx_model_details 'minimized average structure, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2LBN _struct_keywords.pdbx_keywords 'Peptide binding protein, hormone' _struct_keywords.text 'Dimerization, Hormone, Peptide binding protein' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 38 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 49 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 38 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 49 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 10 A CYS 54 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 13 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 13 A CYS 27 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf3 disulf ? ? A CYS 21 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 21 A CYS 44 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf4 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 28 A CYS 34 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf5 disulf ? ? A CYS 61 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 61 A CYS 73 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf6 disulf ? ? A CYS 67 SG ? ? ? 1_555 A CYS 85 SG ? ? A CYS 67 A CYS 85 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf7 disulf ? ? A CYS 74 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 74 A CYS 79 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PRO A 12 ? CYS A 13 ? PRO A 12 CYS A 13 A 2 GLY A 19 ? ARG A 20 ? GLY A 19 ARG A 20 A 3 ILE A 26 ? GLY A 29 ? ILE A 26 GLY A 29 A 4 GLY A 33 ? VAL A 36 ? GLY A 33 VAL A 36 B 1 PRO A 60 ? CYS A 61 ? PRO A 60 CYS A 61 B 2 GLY A 65 ? CYS A 67 ? GLY A 65 CYS A 67 B 3 CYS A 73 ? CYS A 74 ? CYS A 73 CYS A 74 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N CYS A 13 ? N CYS A 13 O GLY A 19 ? O GLY A 19 A 2 3 N ARG A 20 ? N ARG A 20 O CYS A 28 ? O CYS A 28 A 3 4 N GLY A 29 ? N GLY A 29 O GLY A 33 ? O GLY A 33 B 1 2 N CYS A 61 ? N CYS A 61 O GLY A 65 ? O GLY A 65 B 2 3 O ARG A 66 ? O ARG A 66 N CYS A 74 ? N CYS A 74 # _atom_sites.entry_id 2LBN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 CYS 27 27 27 CYS CYS A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 PHE 35 35 35 PHE PHE A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 SER 92 92 92 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-04-04 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1.4 ? mM '[U-100% 15N]' 1 protein-2 1.4 ? mM '[U-100% 13C; U-100% 15N]' 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 66 ? ? H A ALA 68 ? ? 1.59 2 2 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.05 3 2 HA A CYS 10 ? ? HB2 A CYS 54 ? ? 1.14 4 2 HD12 A LEU 5 ? ? HG12 A VAL 7 ? ? 1.17 5 2 HD2 A PRO 15 ? ? HB2 A LYS 18 ? ? 1.19 6 2 HD22 A LEU 5 ? ? HB A VAL 7 ? ? 1.24 7 2 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.25 8 2 HD21 A LEU 32 ? ? HZ A PHE 35 ? ? 1.29 9 2 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.29 10 2 HB3 A ALA 68 ? ? HG23 A ILE 72 ? ? 1.34 11 2 H A GLY 29 ? ? O A GLY 33 ? ? 1.55 12 2 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.56 13 2 O A ASP 82 ? ? H A CYS 85 ? ? 1.57 14 3 HD11 A LEU 5 ? ? H A ARG 8 ? ? 1.12 15 3 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.26 16 3 O A ASP 82 ? ? H A CYS 85 ? ? 1.52 17 3 H A GLY 29 ? ? O A GLY 33 ? ? 1.54 18 3 O A ALA 90 ? ? H A SER 92 ? ? 1.58 19 3 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.59 20 4 HD23 A LEU 5 ? ? H A VAL 7 ? ? 1.02 21 4 HG23 A THR 38 ? ? H A ALA 39 ? ? 1.23 22 4 HA3 A GLY 71 ? ? HD3 A PRO 87 ? ? 1.24 23 4 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.29 24 4 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.29 25 4 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.30 26 4 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.52 27 4 O A ASP 82 ? ? H A CYS 85 ? ? 1.54 28 4 H A GLY 29 ? ? O A GLY 33 ? ? 1.56 29 4 O A GLY 64 ? ? HG A SER 75 ? ? 1.57 30 4 O A ALA 90 ? ? H A SER 92 ? ? 1.57 31 5 HA3 A GLY 29 ? ? HB3 A LEU 32 ? ? 1.27 32 5 O A ARG 66 ? ? H A CYS 74 ? ? 1.43 33 5 O A SER 25 ? ? H A GLY 37 ? ? 1.50 34 5 O A ASP 82 ? ? H A CYS 85 ? ? 1.58 35 6 HD11 A LEU 5 ? ? H A VAL 7 ? ? 1.02 36 6 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.10 37 6 HD2 A PRO 15 ? ? HB2 A LYS 18 ? ? 1.26 38 6 HA3 A GLY 71 ? ? HD3 A PRO 87 ? ? 1.29 39 6 HB2 A PHE 35 ? ? HB2 A ALA 41 ? ? 1.29 40 6 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.30 41 6 HD13 A ILE 26 ? ? HG21 A VAL 36 ? ? 1.30 42 6 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.31 43 6 O A ASP 82 ? ? H A CYS 85 ? ? 1.48 44 6 H A GLY 29 ? ? O A GLY 33 ? ? 1.52 45 6 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.55 46 7 HD21 A LEU 5 ? ? H A VAL 7 ? ? 1.05 47 7 HD22 A LEU 3 ? ? HG2 A PRO 53 ? ? 1.11 48 7 HB2 A LEU 3 ? ? H A GLN 55 ? ? 1.18 49 7 HB2 A CYS 10 ? ? HD3 A ARG 20 ? ? 1.26 50 7 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.27 51 7 HA A ASP 6 ? ? HG23 A THR 9 ? ? 1.28 52 7 HB1 A ALA 68 ? ? HG23 A ILE 72 ? ? 1.29 53 7 HA3 A GLY 71 ? ? HD3 A PRO 87 ? ? 1.29 54 7 HD13 A ILE 26 ? ? HG21 A VAL 36 ? ? 1.32 55 7 HG23 A THR 38 ? ? H A ALA 39 ? ? 1.32 56 7 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.32 57 7 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.33 58 7 HD11 A LEU 5 ? ? HG23 A VAL 7 ? ? 1.34 59 7 O A ASP 82 ? ? H A CYS 85 ? ? 1.50 60 7 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.56 61 7 O A ALA 90 ? ? H A SER 92 ? ? 1.59 62 8 HB2 A LEU 3 ? ? H A ASP 4 ? ? 1.32 63 8 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.33 64 8 O A ASP 82 ? ? H A CYS 85 ? ? 1.44 65 8 O A ARG 66 ? ? H A ALA 68 ? ? 1.47 66 8 O A ALA 90 ? ? H A SER 92 ? ? 1.52 67 8 O A ALA 69 ? ? N A GLY 71 ? ? 2.14 68 8 O A ARG 66 ? ? N A ALA 68 ? ? 2.19 69 9 HD23 A LEU 3 ? ? HD2 A ARG 8 ? ? 1.08 70 9 HD23 A LEU 50 ? ? HG3 A PRO 53 ? ? 1.21 71 9 HD23 A LEU 5 ? ? HG12 A VAL 7 ? ? 1.26 72 9 HD12 A LEU 5 ? ? H A VAL 7 ? ? 1.26 73 9 HA A ILE 72 ? ? HA A GLU 81 ? ? 1.27 74 9 HA2 A GLY 71 ? ? HB3 A CYS 85 ? ? 1.27 75 9 HB2 A CYS 74 ? ? HB3 A CYS 79 ? ? 1.31 76 9 HA3 A GLY 71 ? ? HD3 A PRO 87 ? ? 1.33 77 9 HG3 A LYS 59 ? ? HB3 A CYS 67 ? ? 1.33 78 9 HB2 A GLU 81 ? ? HG2 A PRO 87 ? ? 1.33 79 9 O A ASP 82 ? ? H A CYS 85 ? ? 1.52 80 9 O A ARG 66 ? ? H A CYS 74 ? ? 1.53 81 9 O A ARG 66 ? ? N A CYS 74 ? ? 2.15 82 10 HA2 A GLY 71 ? ? HB3 A CYS 85 ? ? 1.14 83 10 HA3 A GLY 14 ? ? HD13 A LEU 32 ? ? 1.21 84 10 HA A PRO 83 ? ? HA A ALA 89 ? ? 1.22 85 10 HB2 A GLU 81 ? ? HB2 A PRO 87 ? ? 1.26 86 10 HA3 A GLY 29 ? ? HB3 A LEU 32 ? ? 1.28 87 10 HE2 A PHE 22 ? ? HA A ALA 68 ? ? 1.28 88 10 HB2 A CYS 74 ? ? HB3 A CYS 79 ? ? 1.33 89 10 HA A CYS 10 ? ? HB2 A CYS 54 ? ? 1.35 90 10 H A CYS 61 ? ? O A GLY 65 ? ? 1.51 91 10 O A ALA 90 ? ? H A SER 92 ? ? 1.52 92 10 O A ARG 66 ? ? H A CYS 74 ? ? 1.55 93 10 O A ARG 66 ? ? H A ALA 68 ? ? 1.59 94 11 HG23 A THR 38 ? ? H A ALA 39 ? ? 1.24 95 11 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.27 96 11 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.27 97 11 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.29 98 11 HB2 A ALA 68 ? ? HG21 A ILE 72 ? ? 1.30 99 11 HA A CYS 13 ? ? HG2 A ARG 43 ? ? 1.30 100 11 HD23 A LEU 32 ? ? HZ A PHE 35 ? ? 1.31 101 11 HD12 A ILE 26 ? ? HG23 A VAL 36 ? ? 1.32 102 11 O A ASP 82 ? ? H A CYS 85 ? ? 1.48 103 11 O A GLY 64 ? ? HG A SER 75 ? ? 1.55 104 11 H A GLY 29 ? ? O A GLY 33 ? ? 1.56 105 11 O A ALA 90 ? ? H A SER 92 ? ? 1.57 106 12 HD13 A LEU 5 ? ? H A VAL 7 ? ? 1.05 107 12 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.29 108 12 O A ALA 69 ? ? H A GLY 71 ? ? 1.41 109 12 O A GLY 64 ? ? HG A SER 75 ? ? 1.50 110 12 O A ASP 82 ? ? H A CYS 85 ? ? 1.51 111 12 H A GLY 29 ? ? O A GLY 33 ? ? 1.52 112 12 O A ARG 66 ? ? HA A CYS 73 ? ? 1.59 113 12 O A ALA 90 ? ? H A SER 92 ? ? 1.59 114 12 O A ALA 69 ? ? N A GLY 71 ? ? 2.05 115 13 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.29 116 13 HG A LEU 3 ? ? HD3 A ARG 8 ? ? 1.31 117 13 HA2 A GLY 71 ? ? HB3 A CYS 85 ? ? 1.34 118 13 O A ASP 82 ? ? H A CYS 85 ? ? 1.49 119 13 O A SER 25 ? ? H A GLY 37 ? ? 1.57 120 13 H A CYS 61 ? ? O A GLY 65 ? ? 1.60 121 14 HD12 A LEU 5 ? ? H A VAL 7 ? ? 1.05 122 14 HG A SER 56 ? ? H A GLY 57 ? ? 1.17 123 14 HA3 A GLY 71 ? ? HD3 A PRO 87 ? ? 1.20 124 14 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.27 125 14 HD21 A LEU 11 ? ? HG2 A GLU 47 ? ? 1.29 126 14 HH22 A ARG 20 ? ? HA3 A GLY 57 ? ? 1.29 127 14 HB3 A GLN 58 ? ? HB3 A CYS 67 ? ? 1.34 128 14 H A GLY 29 ? ? O A GLY 33 ? ? 1.49 129 14 O A CYS 61 ? ? O A GLY 65 ? ? 2.14 130 15 HG3 A PRO 24 ? ? HB3 A PRO 76 ? ? 1.07 131 15 HG A LEU 5 ? ? HB2 A ARG 8 ? ? 1.10 132 15 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.12 133 15 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.23 134 15 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.23 135 15 HD2 A PRO 15 ? ? HB2 A LYS 18 ? ? 1.26 136 15 HB3 A GLN 58 ? ? HB3 A CYS 67 ? ? 1.29 137 15 HE21 A GLN 58 ? ? H A LYS 59 ? ? 1.31 138 15 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.58 139 15 O A GLY 64 ? ? HG A SER 75 ? ? 1.58 140 15 O A ASP 82 ? ? H A CYS 85 ? ? 1.60 141 16 HA3 A GLY 14 ? ? HD11 A LEU 32 ? ? 1.10 142 16 HA2 A GLY 71 ? ? HB3 A CYS 85 ? ? 1.12 143 16 HG12 A ILE 72 ? ? HA A GLU 81 ? ? 1.23 144 16 HB2 A GLU 81 ? ? HB2 A PRO 87 ? ? 1.24 145 16 HD21 A LEU 32 ? ? HZ A PHE 35 ? ? 1.28 146 16 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.28 147 16 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.33 148 16 O A ARG 66 ? ? H A CYS 74 ? ? 1.57 149 16 H A CYS 61 ? ? O A GLY 65 ? ? 1.57 150 16 O A ARG 66 ? ? H A ALA 68 ? ? 1.58 151 16 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.59 152 17 HD22 A LEU 3 ? ? HD2 A ARG 8 ? ? 1.12 153 17 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.15 154 17 HD13 A LEU 5 ? ? H A VAL 7 ? ? 1.19 155 17 HG22 A THR 38 ? ? H A ALA 39 ? ? 1.22 156 17 HA3 A GLY 71 ? ? HD3 A PRO 87 ? ? 1.27 157 17 HD2 A PRO 15 ? ? HB2 A LYS 18 ? ? 1.27 158 17 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.28 159 17 HD21 A LEU 32 ? ? HZ A PHE 35 ? ? 1.28 160 17 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.29 161 17 HB2 A LEU 3 ? ? HB2 A ARG 8 ? ? 1.34 162 17 O A ASP 82 ? ? H A CYS 85 ? ? 1.51 163 17 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.53 164 17 H A GLY 29 ? ? O A GLY 33 ? ? 1.56 165 17 O A GLN 45 ? ? HD21 A ASN 48 ? ? 1.60 166 18 HD13 A ILE 26 ? ? HG22 A VAL 36 ? ? 1.17 167 18 HG3 A PRO 83 ? ? HB3 A GLU 88 ? ? 1.18 168 18 HG22 A THR 38 ? ? H A ALA 39 ? ? 1.23 169 18 HB3 A SER 75 ? ? HD3 A PRO 76 ? ? 1.24 170 18 HB3 A SER 63 ? ? HB3 A CYS 73 ? ? 1.24 171 18 HG A LEU 3 ? ? HG2 A ARG 8 ? ? 1.24 172 18 HG3 A PRO 24 ? ? HB3 A PRO 76 ? ? 1.27 173 18 HG12 A ILE 72 ? ? HA A GLU 81 ? ? 1.28 174 18 O A ALA 70 ? ? HG3 A PRO 87 ? ? 1.58 175 18 O A ASP 82 ? ? H A CYS 85 ? ? 1.59 176 19 O A GLY 64 ? ? HG A SER 75 ? ? 1.51 177 19 H A GLY 29 ? ? O A GLY 33 ? ? 1.54 178 19 O A ASP 82 ? ? H A CYS 85 ? ? 1.55 179 19 O A THR 38 ? ? H A ALA 41 ? ? 1.57 180 19 O A ALA 90 ? ? H A SER 92 ? ? 1.58 181 20 HA3 A GLY 29 ? ? HB3 A LEU 32 ? ? 1.31 182 20 HA3 A GLY 14 ? ? HD12 A LEU 32 ? ? 1.33 183 20 H A CYS 61 ? ? O A GLY 65 ? ? 1.49 184 20 O A SER 25 ? ? H A GLY 37 ? ? 1.50 185 20 O A GLY 14 ? ? HH21 A ARG 43 ? ? 1.57 186 20 O A ASP 82 ? ? H A CYS 85 ? ? 1.58 187 20 O A ARG 66 ? ? HA A CYS 73 ? ? 1.59 188 21 HA3 A GLY 29 ? ? HB3 A LEU 32 ? ? 1.22 189 21 HA A PRO 83 ? ? HA A ALA 89 ? ? 1.34 190 21 H A CYS 61 ? ? O A GLY 65 ? ? 1.43 191 21 O A ARG 66 ? ? H A ALA 68 ? ? 1.59 192 21 O A ALA 90 ? ? H A SER 92 ? ? 1.60 193 21 H A CYS 73 ? ? OD2 A ASP 82 ? ? 1.60 194 21 O A GLU 80 ? ? OD2 A ASP 82 ? ? 2.14 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 16 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 CYS _pdbx_validate_rmsd_angle.auth_seq_id_1 73 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 CYS _pdbx_validate_rmsd_angle.auth_seq_id_2 73 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 CYS _pdbx_validate_rmsd_angle.auth_seq_id_3 73 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 119.68 _pdbx_validate_rmsd_angle.angle_target_value 111.50 _pdbx_validate_rmsd_angle.angle_deviation 8.18 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? 42.77 -157.92 2 1 ASP A 4 ? ? 100.02 -50.10 3 1 LEU A 5 ? ? -160.35 -28.22 4 1 ASP A 6 ? ? 168.04 -25.68 5 1 VAL A 7 ? ? -152.53 8.55 6 1 CYS A 10 ? ? 45.03 -144.00 7 1 PRO A 12 ? ? -49.17 168.39 8 1 ARG A 20 ? ? -172.52 -179.36 9 1 SER A 25 ? ? 40.68 28.76 10 1 ASP A 30 ? ? -53.72 -81.02 11 1 PRO A 51 ? ? -62.23 88.90 12 1 CYS A 54 ? ? 162.28 118.64 13 1 GLN A 55 ? ? 27.25 -153.00 14 1 SER A 56 ? ? -173.52 -162.41 15 1 LYS A 59 ? ? 24.25 93.17 16 1 PRO A 60 ? ? -49.34 151.97 17 1 CYS A 67 ? ? -62.78 69.09 18 1 ALA A 68 ? ? -49.48 -84.67 19 1 ALA A 70 ? ? 25.17 42.50 20 1 SER A 75 ? ? -135.08 -151.84 21 1 GLU A 81 ? ? -52.77 99.37 22 1 PRO A 83 ? ? -56.88 -2.89 23 1 CYS A 85 ? ? -145.39 -47.20 24 1 ASP A 86 ? ? -174.79 -28.42 25 1 PRO A 87 ? ? -93.27 -81.16 26 1 ALA A 90 ? ? -88.75 -84.89 27 2 LEU A 5 ? ? -82.42 -150.97 28 2 THR A 9 ? ? -164.10 75.38 29 2 CYS A 10 ? ? -46.86 171.70 30 2 PRO A 12 ? ? -46.88 168.81 31 2 CYS A 13 ? ? -150.69 -159.39 32 2 SER A 25 ? ? 54.13 17.05 33 2 ASP A 30 ? ? -70.42 -81.02 34 2 ARG A 43 ? ? -49.04 -17.99 35 2 PRO A 51 ? ? -48.43 -179.80 36 2 SER A 52 ? ? -107.96 66.33 37 2 CYS A 54 ? ? 173.22 126.60 38 2 GLN A 55 ? ? 43.90 -162.49 39 2 SER A 56 ? ? 179.45 104.77 40 2 LYS A 59 ? ? -12.35 83.12 41 2 ALA A 68 ? ? -22.51 -65.19 42 2 ALA A 70 ? ? 25.58 44.62 43 2 SER A 75 ? ? -126.56 -140.05 44 2 ASP A 86 ? ? 166.58 -21.92 45 2 PRO A 87 ? ? -97.83 -67.58 46 2 ALA A 89 ? ? -68.65 -179.51 47 2 ALA A 90 ? ? -101.46 -156.42 48 3 ASP A 4 ? ? -80.12 -76.70 49 3 LEU A 5 ? ? -72.96 -79.12 50 3 ASP A 6 ? ? -155.06 -60.10 51 3 CYS A 10 ? ? -60.02 -93.30 52 3 PRO A 12 ? ? -47.67 170.20 53 3 ASP A 30 ? ? -74.75 -80.46 54 3 GLU A 47 ? ? -68.81 0.49 55 3 TYR A 49 ? ? -160.76 112.59 56 3 PRO A 51 ? ? -52.74 -168.04 57 3 SER A 56 ? ? 170.66 170.19 58 3 LYS A 59 ? ? -15.73 86.79 59 3 ALA A 68 ? ? -23.80 -64.99 60 3 ALA A 70 ? ? 18.23 65.29 61 3 SER A 75 ? ? -129.14 -137.41 62 3 ASP A 86 ? ? 165.77 -22.82 63 3 PRO A 87 ? ? -102.28 -68.33 64 3 ALA A 90 ? ? -98.71 -157.23 65 4 ASP A 4 ? ? -72.11 -89.59 66 4 LEU A 5 ? ? -82.78 -82.48 67 4 ASP A 6 ? ? -158.41 -28.90 68 4 THR A 9 ? ? -167.84 89.10 69 4 CYS A 10 ? ? -76.01 -168.87 70 4 PRO A 12 ? ? -62.41 -178.72 71 4 SER A 25 ? ? 53.33 16.97 72 4 ASP A 30 ? ? -72.62 -81.54 73 4 GLU A 40 ? ? -68.12 9.25 74 4 ARG A 43 ? ? -48.73 -17.68 75 4 PRO A 51 ? ? -53.28 -163.92 76 4 SER A 52 ? ? 75.93 155.54 77 4 PRO A 53 ? ? -90.09 -72.94 78 4 CYS A 54 ? ? 58.61 155.37 79 4 GLN A 55 ? ? 45.06 -95.91 80 4 SER A 56 ? ? 46.64 98.17 81 4 LYS A 59 ? ? -10.11 94.07 82 4 ALA A 68 ? ? -23.31 -66.94 83 4 ALA A 70 ? ? 17.92 63.13 84 4 SER A 75 ? ? -123.99 -140.02 85 4 ASP A 86 ? ? 171.56 -27.24 86 4 PRO A 87 ? ? -106.21 -69.87 87 4 ALA A 90 ? ? -100.66 -150.59 88 5 VAL A 2 ? ? 65.81 164.20 89 5 ASP A 4 ? ? -81.21 -74.76 90 5 LEU A 5 ? ? -75.69 -80.10 91 5 ASP A 6 ? ? -158.62 -58.51 92 5 CYS A 10 ? ? -147.16 -46.96 93 5 SER A 25 ? ? 43.01 23.41 94 5 ASP A 30 ? ? -73.39 -72.69 95 5 GLU A 40 ? ? -60.18 10.95 96 5 PRO A 51 ? ? -45.77 84.23 97 5 SER A 52 ? ? 172.68 113.85 98 5 PRO A 53 ? ? -95.12 -61.30 99 5 CYS A 54 ? ? 79.61 147.84 100 5 LYS A 59 ? ? -94.30 43.57 101 5 SER A 63 ? ? -93.06 38.06 102 5 ALA A 68 ? ? -39.40 -98.81 103 5 ALA A 69 ? ? -68.85 -159.87 104 5 SER A 75 ? ? -113.78 -137.23 105 5 ASP A 86 ? ? 166.32 -21.99 106 5 PRO A 87 ? ? -102.35 -68.94 107 5 ALA A 89 ? ? -65.16 -175.17 108 5 ALA A 90 ? ? -100.23 -158.24 109 5 PHE A 91 ? ? -62.53 1.88 110 6 ASP A 4 ? ? -67.17 -127.61 111 6 LEU A 5 ? ? -91.97 -137.49 112 6 VAL A 7 ? ? -86.81 46.42 113 6 THR A 9 ? ? 66.74 96.79 114 6 CYS A 10 ? ? -42.54 175.03 115 6 PRO A 12 ? ? -65.97 -174.77 116 6 SER A 25 ? ? 54.46 17.71 117 6 ASP A 30 ? ? -72.31 -80.95 118 6 GLU A 40 ? ? -67.47 9.03 119 6 SER A 52 ? ? -141.71 52.36 120 6 CYS A 54 ? ? -77.44 -151.68 121 6 GLN A 55 ? ? -31.95 154.63 122 6 LYS A 59 ? ? -15.98 85.47 123 6 CYS A 67 ? ? -77.03 48.79 124 6 ALA A 68 ? ? -19.98 -67.59 125 6 ALA A 70 ? ? 16.44 67.45 126 6 SER A 75 ? ? -126.59 -137.82 127 6 ASP A 86 ? ? 167.79 -24.00 128 6 PRO A 87 ? ? -100.78 -67.50 129 6 ALA A 90 ? ? -100.99 -158.07 130 7 ASP A 4 ? ? -92.78 -72.58 131 7 LEU A 5 ? ? -91.75 -158.51 132 7 THR A 9 ? ? -27.51 162.41 133 7 CYS A 10 ? ? -44.90 174.82 134 7 CYS A 13 ? ? -147.82 -158.76 135 7 SER A 25 ? ? 54.65 16.93 136 7 ASP A 30 ? ? -72.54 -81.00 137 7 GLU A 40 ? ? -66.65 9.90 138 7 TYR A 49 ? ? -106.94 -70.01 139 7 PRO A 51 ? ? -49.97 168.93 140 7 CYS A 54 ? ? -140.41 40.59 141 7 GLN A 55 ? ? 53.50 -155.70 142 7 LYS A 59 ? ? -14.16 88.20 143 7 CYS A 67 ? ? -76.69 49.04 144 7 ALA A 68 ? ? -21.55 -63.56 145 7 ALA A 70 ? ? 15.53 66.09 146 7 SER A 75 ? ? -123.19 -138.58 147 7 ASP A 86 ? ? 169.14 -26.51 148 7 PRO A 87 ? ? -102.52 -68.37 149 7 ALA A 90 ? ? -98.87 -155.28 150 8 LEU A 3 ? ? -68.51 -147.82 151 8 ASP A 4 ? ? -157.12 -12.46 152 8 LEU A 5 ? ? -18.13 -77.98 153 8 ASP A 6 ? ? -166.50 -28.12 154 8 CYS A 10 ? ? -65.73 -173.33 155 8 PRO A 12 ? ? -53.12 172.84 156 8 PHE A 22 ? ? -154.08 -45.27 157 8 SER A 25 ? ? 57.16 17.90 158 8 ASP A 30 ? ? -74.70 -81.81 159 8 THR A 38 ? ? -74.16 -169.46 160 8 TYR A 49 ? ? -60.51 -143.73 161 8 PRO A 51 ? ? -45.10 169.00 162 8 GLN A 55 ? ? 40.02 -176.82 163 8 LYS A 59 ? ? -90.93 53.89 164 8 CYS A 67 ? ? -37.81 57.90 165 8 ALA A 68 ? ? -30.17 -35.74 166 8 ALA A 70 ? ? -9.38 -43.74 167 8 SER A 75 ? ? -132.02 -139.47 168 8 ASP A 86 ? ? 160.55 -20.21 169 8 PRO A 87 ? ? -98.13 -68.65 170 8 ALA A 90 ? ? -97.01 -154.60 171 8 PHE A 91 ? ? -71.80 45.88 172 9 LEU A 3 ? ? -56.37 -177.59 173 9 ASP A 4 ? ? -144.81 -25.28 174 9 LEU A 5 ? ? -67.10 -135.84 175 9 CYS A 10 ? ? -169.60 59.39 176 9 SER A 25 ? ? 53.02 9.87 177 9 ASP A 30 ? ? -72.46 -81.03 178 9 GLU A 40 ? ? -66.02 11.97 179 9 TYR A 49 ? ? -137.74 -35.92 180 9 SER A 52 ? ? -42.99 96.57 181 9 PRO A 53 ? ? -96.66 39.42 182 9 CYS A 54 ? ? 152.34 157.15 183 9 LYS A 59 ? ? -92.04 37.23 184 9 SER A 63 ? ? -85.20 40.73 185 9 CYS A 67 ? ? -58.53 170.39 186 9 ALA A 68 ? ? -156.57 -94.83 187 9 ALA A 69 ? ? -78.06 -158.01 188 9 ALA A 70 ? ? -56.32 95.74 189 9 SER A 75 ? ? -112.57 -137.72 190 9 ASP A 86 ? ? 170.54 -27.04 191 9 PRO A 87 ? ? -105.87 -64.01 192 9 ALA A 89 ? ? -53.86 -106.68 193 9 ALA A 90 ? ? -63.35 -147.63 194 10 LEU A 3 ? ? -66.10 -177.68 195 10 ASP A 4 ? ? -83.13 -95.42 196 10 LEU A 5 ? ? -77.93 -75.95 197 10 ASP A 6 ? ? -154.06 -48.06 198 10 THR A 9 ? ? -151.71 86.40 199 10 CYS A 10 ? ? 62.84 -171.48 200 10 SER A 25 ? ? 48.70 19.03 201 10 ASP A 30 ? ? -69.35 -73.05 202 10 GLU A 40 ? ? -63.99 11.35 203 10 ASN A 48 ? ? -148.42 10.75 204 10 TYR A 49 ? ? -142.06 -64.67 205 10 GLN A 55 ? ? -57.90 -178.99 206 10 SER A 56 ? ? -61.26 -169.75 207 10 LYS A 59 ? ? -39.47 120.17 208 10 PRO A 60 ? ? -45.47 167.63 209 10 SER A 63 ? ? -92.37 35.56 210 10 ALA A 68 ? ? -42.22 -97.48 211 10 ALA A 69 ? ? -67.27 -159.00 212 10 ALA A 70 ? ? -56.49 80.85 213 10 SER A 75 ? ? -108.81 -138.19 214 10 GLU A 81 ? ? -49.35 89.29 215 10 PRO A 83 ? ? -60.75 4.84 216 10 ASP A 86 ? ? 159.73 -16.60 217 10 PRO A 87 ? ? -95.06 -66.44 218 10 ALA A 89 ? ? -16.83 126.68 219 10 ALA A 90 ? ? -99.36 -148.12 220 11 ASP A 4 ? ? -76.60 -89.05 221 11 ASP A 6 ? ? -163.50 -48.78 222 11 CYS A 10 ? ? 68.60 -168.18 223 11 PRO A 12 ? ? -43.64 165.04 224 11 SER A 25 ? ? 55.24 15.44 225 11 ASP A 30 ? ? -70.90 -81.01 226 11 GLU A 40 ? ? -68.26 8.13 227 11 ARG A 43 ? ? -48.30 -19.45 228 11 TYR A 49 ? ? -88.97 -75.02 229 11 GLN A 55 ? ? -56.15 -78.84 230 11 LYS A 59 ? ? -14.37 85.49 231 11 ALA A 68 ? ? -21.13 -66.06 232 11 ALA A 70 ? ? 15.36 69.84 233 11 SER A 75 ? ? -128.12 -137.94 234 11 ASP A 86 ? ? 165.06 -22.48 235 11 PRO A 87 ? ? -99.53 -67.46 236 11 ALA A 90 ? ? -98.04 -154.07 237 11 PHE A 91 ? ? -74.94 49.41 238 12 VAL A 2 ? ? 44.94 -174.32 239 12 ASP A 4 ? ? -81.16 -77.24 240 12 ASP A 6 ? ? -166.25 -48.92 241 12 CYS A 10 ? ? -47.14 177.03 242 12 PRO A 12 ? ? -48.97 164.84 243 12 CYS A 13 ? ? -147.86 -158.51 244 12 ASP A 30 ? ? -74.49 -78.99 245 12 GLU A 40 ? ? -68.33 7.34 246 12 ARG A 43 ? ? -48.94 -18.65 247 12 TYR A 49 ? ? -96.10 -62.15 248 12 CYS A 54 ? ? 174.60 -166.99 249 12 GLN A 55 ? ? -69.87 -81.89 250 12 SER A 56 ? ? 58.49 109.32 251 12 LYS A 59 ? ? -16.54 85.19 252 12 CYS A 67 ? ? -80.02 46.13 253 12 ALA A 68 ? ? -24.15 -59.67 254 12 ALA A 70 ? ? 37.93 -3.30 255 12 SER A 75 ? ? -128.68 -138.26 256 12 ASP A 86 ? ? 160.40 -20.21 257 12 PRO A 87 ? ? -100.20 -65.18 258 12 ALA A 90 ? ? -98.83 -156.13 259 13 VAL A 2 ? ? -57.43 -179.69 260 13 ASP A 4 ? ? -78.38 -115.02 261 13 LEU A 5 ? ? -94.22 -144.33 262 13 VAL A 7 ? ? -107.95 61.98 263 13 ARG A 8 ? ? -69.99 -169.72 264 13 THR A 9 ? ? 34.94 39.00 265 13 CYS A 10 ? ? 55.08 176.23 266 13 CYS A 13 ? ? -129.22 -163.93 267 13 SER A 25 ? ? 54.80 12.63 268 13 ASP A 30 ? ? -68.76 -81.02 269 13 GLU A 47 ? ? -78.19 25.94 270 13 PRO A 51 ? ? -36.93 130.69 271 13 CYS A 54 ? ? 175.65 123.14 272 13 GLN A 55 ? ? 41.96 -130.94 273 13 SER A 56 ? ? -174.83 -156.48 274 13 LYS A 59 ? ? -19.91 89.11 275 13 PRO A 60 ? ? -46.78 158.80 276 13 SER A 63 ? ? -83.56 38.09 277 13 ALA A 68 ? ? -153.39 -87.57 278 13 ALA A 69 ? ? -67.30 -160.25 279 13 SER A 75 ? ? -118.12 -136.43 280 13 ASP A 86 ? ? 167.61 -25.85 281 13 PRO A 87 ? ? -104.06 -70.51 282 13 ALA A 89 ? ? -64.17 -174.90 283 13 ALA A 90 ? ? -101.53 -152.90 284 13 PHE A 91 ? ? -63.41 1.02 285 14 VAL A 2 ? ? -58.27 -179.09 286 14 ASP A 4 ? ? -72.52 -77.37 287 14 ASP A 6 ? ? -160.03 -47.63 288 14 THR A 9 ? ? -73.85 -169.75 289 14 CYS A 10 ? ? -65.75 -171.99 290 14 PHE A 22 ? ? -156.70 -43.31 291 14 SER A 25 ? ? 56.40 14.82 292 14 ASP A 30 ? ? -72.12 -81.01 293 14 TYR A 49 ? ? -74.10 -79.03 294 14 PRO A 51 ? ? -44.05 104.76 295 14 GLN A 55 ? ? -46.67 -86.93 296 14 SER A 56 ? ? 176.74 -174.61 297 14 PRO A 60 ? ? -44.68 166.07 298 14 ALA A 70 ? ? 28.54 39.56 299 14 SER A 75 ? ? -125.07 -137.64 300 14 ASP A 86 ? ? 163.93 -21.15 301 14 PRO A 87 ? ? -103.66 -65.75 302 14 ALA A 89 ? ? -54.19 -83.98 303 14 ALA A 90 ? ? -79.94 -129.26 304 15 ASP A 4 ? ? -81.41 -71.32 305 15 LEU A 5 ? ? -73.84 -78.30 306 15 ASP A 6 ? ? -156.31 -65.88 307 15 CYS A 10 ? ? -77.73 -85.08 308 15 PRO A 12 ? ? -54.63 173.24 309 15 CYS A 13 ? ? -150.31 -155.39 310 15 ASP A 30 ? ? -70.83 -80.94 311 15 THR A 38 ? ? -57.92 -175.89 312 15 ARG A 43 ? ? -48.82 -16.52 313 15 TYR A 49 ? ? -99.08 -73.26 314 15 PRO A 51 ? ? -45.76 161.05 315 15 SER A 52 ? ? -177.01 115.75 316 15 PRO A 53 ? ? -89.36 -94.45 317 15 CYS A 54 ? ? 48.04 -177.69 318 15 GLN A 55 ? ? 64.58 173.09 319 15 SER A 56 ? ? -166.76 -168.94 320 15 PRO A 60 ? ? -48.12 171.72 321 15 ALA A 68 ? ? -21.65 -68.62 322 15 ALA A 70 ? ? 32.71 34.95 323 15 SER A 75 ? ? -131.79 -139.83 324 15 ASP A 86 ? ? 164.50 -20.11 325 15 PRO A 87 ? ? -94.48 -67.38 326 15 ALA A 90 ? ? -99.05 -155.12 327 16 VAL A 2 ? ? -63.25 -169.62 328 16 ASP A 4 ? ? -73.92 -129.45 329 16 LEU A 5 ? ? -90.33 -137.38 330 16 ARG A 8 ? ? -54.72 -178.63 331 16 THR A 9 ? ? 51.17 103.45 332 16 CYS A 10 ? ? -53.43 -171.03 333 16 SER A 25 ? ? 54.42 10.97 334 16 ASP A 30 ? ? -71.39 -80.99 335 16 GLU A 40 ? ? -66.58 13.64 336 16 ASN A 48 ? ? -157.12 10.66 337 16 PRO A 51 ? ? -44.77 150.12 338 16 PRO A 53 ? ? -37.07 91.50 339 16 CYS A 54 ? ? -169.26 111.12 340 16 GLN A 55 ? ? 45.11 -121.52 341 16 SER A 56 ? ? -168.36 -80.42 342 16 LYS A 59 ? ? -26.71 109.68 343 16 PRO A 60 ? ? -47.15 168.75 344 16 SER A 63 ? ? -88.82 34.61 345 16 ALA A 68 ? ? -42.17 -98.06 346 16 ALA A 69 ? ? -66.53 -155.01 347 16 ALA A 70 ? ? -61.61 83.51 348 16 SER A 75 ? ? -119.38 -139.22 349 16 GLU A 81 ? ? -56.19 84.66 350 16 PRO A 83 ? ? -59.19 2.60 351 16 ASP A 86 ? ? 160.09 -17.44 352 16 PRO A 87 ? ? -94.71 -67.35 353 16 ALA A 89 ? ? -58.49 174.69 354 16 ALA A 90 ? ? -103.48 -158.45 355 17 LEU A 5 ? ? -71.94 -104.11 356 17 ASP A 6 ? ? -149.19 -14.74 357 17 CYS A 10 ? ? -56.20 -93.06 358 17 PRO A 12 ? ? -47.86 170.30 359 17 SER A 25 ? ? 55.40 15.48 360 17 ASP A 30 ? ? -72.64 -80.93 361 17 GLU A 40 ? ? -66.69 9.37 362 17 ARG A 43 ? ? -48.64 -13.15 363 17 GLU A 47 ? ? -65.20 2.71 364 17 LEU A 50 ? ? -105.37 74.29 365 17 PRO A 51 ? ? -54.32 -166.94 366 17 SER A 52 ? ? -152.41 -65.55 367 17 CYS A 54 ? ? -172.63 -162.40 368 17 GLN A 55 ? ? -78.43 -169.28 369 17 SER A 56 ? ? 178.50 -76.51 370 17 LYS A 59 ? ? -14.49 85.34 371 17 CYS A 67 ? ? -77.73 48.78 372 17 ALA A 68 ? ? -20.68 -66.54 373 17 ALA A 70 ? ? 15.44 67.40 374 17 SER A 75 ? ? -126.73 -138.68 375 17 ASP A 86 ? ? 168.30 -24.83 376 17 PRO A 87 ? ? -101.61 -68.06 377 17 ALA A 89 ? ? -68.52 -179.02 378 17 ALA A 90 ? ? -100.71 -156.03 379 18 ASP A 4 ? ? -63.75 -146.92 380 18 LEU A 5 ? ? -87.14 -107.66 381 18 THR A 9 ? ? 43.63 72.94 382 18 CYS A 10 ? ? -78.98 -79.01 383 18 ASP A 30 ? ? -70.39 -80.96 384 18 THR A 38 ? ? -57.09 179.03 385 18 GLU A 40 ? ? -69.10 10.95 386 18 ARG A 43 ? ? -49.57 -16.02 387 18 TYR A 49 ? ? -99.03 -63.01 388 18 SER A 52 ? ? -155.77 51.00 389 18 GLN A 55 ? ? 161.60 -158.76 390 18 SER A 56 ? ? -179.70 -169.35 391 18 LYS A 59 ? ? -11.35 85.15 392 18 ALA A 68 ? ? -16.40 -81.01 393 18 ALA A 70 ? ? 37.24 31.48 394 18 SER A 75 ? ? -127.44 -140.62 395 18 ASP A 86 ? ? 171.41 -27.05 396 18 PRO A 87 ? ? -100.61 -68.10 397 18 ALA A 90 ? ? -100.47 -156.78 398 19 LEU A 3 ? ? -63.28 -154.54 399 19 ASP A 4 ? ? -141.14 -8.80 400 19 LEU A 5 ? ? -55.57 -160.36 401 19 VAL A 7 ? ? -84.91 32.73 402 19 ARG A 8 ? ? -64.96 -164.94 403 19 THR A 9 ? ? 74.44 86.41 404 19 CYS A 10 ? ? -78.75 -138.43 405 19 SER A 25 ? ? 39.25 32.11 406 19 ASP A 30 ? ? -74.69 -72.98 407 19 ARG A 43 ? ? -48.91 -19.33 408 19 PRO A 51 ? ? -44.97 166.28 409 19 SER A 52 ? ? 62.76 103.51 410 19 CYS A 54 ? ? -118.92 -169.13 411 19 GLN A 55 ? ? 58.95 164.14 412 19 SER A 56 ? ? -153.41 -159.07 413 19 LYS A 59 ? ? -14.26 95.61 414 19 ALA A 68 ? ? -22.37 -67.95 415 19 ALA A 70 ? ? 22.35 52.38 416 19 SER A 75 ? ? -125.88 -137.54 417 19 ASP A 86 ? ? 165.43 -21.77 418 19 PRO A 87 ? ? -102.93 -68.48 419 19 ALA A 90 ? ? -99.59 -154.82 420 20 ASP A 4 ? ? -75.35 -122.53 421 20 LEU A 5 ? ? -96.10 -135.75 422 20 VAL A 7 ? ? -96.74 46.60 423 20 CYS A 10 ? ? 24.11 -150.30 424 20 SER A 25 ? ? 47.98 18.93 425 20 ASP A 30 ? ? -73.56 -73.01 426 20 GLU A 40 ? ? -64.45 12.04 427 20 ARG A 43 ? ? -58.98 -10.00 428 20 TYR A 49 ? ? -65.91 -77.43 429 20 PRO A 51 ? ? -40.68 92.98 430 20 SER A 52 ? ? -150.69 59.03 431 20 PRO A 53 ? ? -65.88 82.02 432 20 GLN A 55 ? ? 39.54 82.72 433 20 SER A 56 ? ? -55.47 -87.87 434 20 LYS A 59 ? ? -22.14 92.28 435 20 PRO A 60 ? ? -45.34 163.63 436 20 SER A 63 ? ? -90.71 38.90 437 20 CYS A 67 ? ? -73.52 43.54 438 20 ALA A 68 ? ? -25.97 -97.77 439 20 ALA A 69 ? ? -70.76 -159.88 440 20 SER A 75 ? ? -123.84 -137.19 441 20 ASP A 86 ? ? 173.07 -28.66 442 20 PRO A 87 ? ? -111.88 -73.06 443 20 ALA A 89 ? ? -64.00 -176.46 444 20 ALA A 90 ? ? -101.63 -162.47 445 21 LEU A 5 ? ? -89.13 -71.55 446 21 ASP A 6 ? ? -152.69 -65.36 447 21 CYS A 10 ? ? 61.95 132.83 448 21 SER A 25 ? ? 46.80 20.26 449 21 ASP A 30 ? ? -70.82 -71.14 450 21 GLU A 40 ? ? -64.20 10.52 451 21 PRO A 51 ? ? -45.91 151.87 452 21 GLN A 55 ? ? -24.86 123.06 453 21 SER A 56 ? ? 68.41 138.15 454 21 LYS A 59 ? ? -32.36 110.36 455 21 PRO A 60 ? ? -47.67 171.23 456 21 SER A 63 ? ? -95.27 38.87 457 21 CYS A 67 ? ? -71.03 44.56 458 21 ALA A 68 ? ? -14.56 -95.87 459 21 SER A 75 ? ? -119.07 -137.72 460 21 GLU A 81 ? ? -53.06 85.00 461 21 PRO A 83 ? ? -60.97 1.43 462 21 ASP A 86 ? ? 156.69 -15.05 463 21 PRO A 87 ? ? -95.46 -66.99 464 21 ALA A 89 ? ? -16.09 124.72 465 21 ALA A 90 ? ? -99.24 -138.44 466 21 PHE A 91 ? ? -73.19 47.48 #