data_2LBX # _entry.id 2LBX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LBX pdb_00002lbx 10.2210/pdb2lbx/pdb RCSB RCSB102207 ? ? BMRB 17579 ? ? WWPDB D_1000102207 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17579 BMRB unspecified . 2LBW PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LBX _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2011-04-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Koo, B.' 1 'Park, C.' 2 'Fernandez, C.F.' 3 'Chim, N.' 4 'Ding, Y.' 5 'Chanfreau, G.' 6 'Feigon, J.' 7 # _citation.id primary _citation.title 'Structure of H/ACA RNP Protein Nhp2p Reveals Cis/Trans Isomerization of a Conserved Proline at the RNA and Nop10 Binding Interface.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 411 _citation.page_first 927 _citation.page_last 942 _citation.year 2011 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21708174 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2011.06.022 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Koo, B.K.' 1 ? primary 'Park, C.J.' 2 ? primary 'Fernandez, C.F.' 3 ? primary 'Chim, N.' 4 ? primary 'Ding, Y.' 5 ? primary 'Chanfreau, G.' 6 ? primary 'Feigon, J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'H/ACA ribonucleoprotein complex subunit 2' _entity.formula_weight 13207.521 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'sequence database residues 36-156' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'H/ACA snoRNP protein NHP2, High mobility group-like nuclear protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGA TKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL ; _entity_poly.pdbx_seq_one_letter_code_can ;SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGA TKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 LYS n 1 4 LEU n 1 5 ASN n 1 6 LYS n 1 7 LYS n 1 8 VAL n 1 9 LEU n 1 10 LYS n 1 11 THR n 1 12 VAL n 1 13 LYS n 1 14 LYS n 1 15 ALA n 1 16 SER n 1 17 LYS n 1 18 ALA n 1 19 LYS n 1 20 ASN n 1 21 VAL n 1 22 LYS n 1 23 ARG n 1 24 GLY n 1 25 VAL n 1 26 LYS n 1 27 GLU n 1 28 VAL n 1 29 VAL n 1 30 LYS n 1 31 ALA n 1 32 LEU n 1 33 ARG n 1 34 LYS n 1 35 GLY n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 LEU n 1 40 VAL n 1 41 VAL n 1 42 ILE n 1 43 ALA n 1 44 GLY n 1 45 ASP n 1 46 ILE n 1 47 SER n 1 48 PRO n 1 49 ALA n 1 50 ASP n 1 51 VAL n 1 52 ILE n 1 53 SER n 1 54 HIS n 1 55 ILE n 1 56 PRO n 1 57 VAL n 1 58 LEU n 1 59 CYS n 1 60 GLU n 1 61 ASP n 1 62 HIS n 1 63 SER n 1 64 VAL n 1 65 PRO n 1 66 TYR n 1 67 ILE n 1 68 PHE n 1 69 ILE n 1 70 PRO n 1 71 SER n 1 72 LYS n 1 73 GLN n 1 74 ASP n 1 75 LEU n 1 76 GLY n 1 77 ALA n 1 78 ALA n 1 79 GLY n 1 80 ALA n 1 81 THR n 1 82 LYS n 1 83 ARG n 1 84 PRO n 1 85 THR n 1 86 SER n 1 87 VAL n 1 88 VAL n 1 89 PHE n 1 90 ILE n 1 91 VAL n 1 92 PRO n 1 93 GLY n 1 94 SER n 1 95 ASN n 1 96 LYS n 1 97 LYS n 1 98 LYS n 1 99 ASP n 1 100 GLY n 1 101 LYS n 1 102 ASN n 1 103 LYS n 1 104 GLU n 1 105 GLU n 1 106 GLU n 1 107 TYR n 1 108 LYS n 1 109 GLU n 1 110 SER n 1 111 PHE n 1 112 ASN n 1 113 GLU n 1 114 VAL n 1 115 VAL n 1 116 LYS n 1 117 GLU n 1 118 VAL n 1 119 GLN n 1 120 ALA n 1 121 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name yeast _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NHP2, YDL208W, D1045' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4932 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Saccharomyces cerevisiae' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 4932 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET24a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NHP2_YEAST _struct_ref.pdbx_db_accession P32495 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SKKLNKKVLKTVKKASKAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHSVPYIFIPSKQDLGAAGA TKRPTSVVFIVPGSNKKKDGKNKEEEYKESFNEVVKEVQAL ; _struct_ref.pdbx_align_begin 36 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LBX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P32495 _struct_ref_seq.db_align_beg 36 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 156 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 36 _struct_ref_seq.pdbx_auth_seq_align_end 156 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCACB' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 2 '3D HBHA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 3 '3D 1H-13C NOESY' 1 7 2 '3D 1H-15N NOESY' 1 8 2 '2D 1H-15N HSQC' 1 9 1 '2D 1H-13C HSQC' 1 10 1 '3D C(CO)NH' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.2 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '20 mM [U-13C; U-15N] HEPES, 200 mM [U-13C; U-15N] potassium chloride, 1 mM [U-13C; U-15N] DTT, 100% D2O' 1 '100% D2O' '20 mM [U-15N] HEPES, 200 mM [U-15N] potassium chloride, 1 mM [U-15N] DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '20 mM [U-13C; U-15N] HEPES, 200 mM [U-13C; U-15N] potassium chloride, 1 mM [U-13C; U-15N] DTT, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker DRX 1 'Bruker DRX' 600 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2LBX _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LBX _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LBX _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 Goddard 'chemical shift assignment' Sparky ? 2 Goddard 'data analysis' Sparky ? 3 Goddard 'peak picking' Sparky ? 4 'Bruker Biospin' collection TopSpin ? 5 'Laskowski and MacArthur' 'data analysis' ProcheckNMR ? 6 'Cornilescu, Delaglio and Bax' 'geometry optimization' TALOS ? 7 'Bruker Biospin' collection XwinNMR ? 8 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 9 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LBX _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LBX _struct.title 'Solution structure of the S. cerevisiae H/ACA RNP protein Nhp2p' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LBX _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text 'L7Ae, snoRNP, scaRNP, RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 1 ? ALA A 18 ? SER A 36 ALA A 53 1 ? 18 HELX_P HELX_P2 2 GLY A 24 ? LYS A 34 ? GLY A 59 LYS A 69 1 ? 11 HELX_P HELX_P3 3 PRO A 48 ? HIS A 62 ? PRO A 83 HIS A 97 1 ? 15 HELX_P HELX_P4 4 SER A 71 ? ALA A 80 ? SER A 106 ALA A 115 1 ? 10 HELX_P HELX_P5 5 LYS A 96 ? GLY A 100 ? LYS A 131 GLY A 135 5 ? 5 HELX_P HELX_P6 6 LYS A 103 ? LEU A 121 ? LYS A 138 LEU A 156 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 21 ? ARG A 23 ? VAL A 56 ARG A 58 A 2 VAL A 87 ? ILE A 90 ? VAL A 122 ILE A 125 A 3 LEU A 39 ? ALA A 43 ? LEU A 74 ALA A 78 A 4 TYR A 66 ? ILE A 69 ? TYR A 101 ILE A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 22 ? N LYS A 57 O PHE A 89 ? O PHE A 124 A 2 3 O ILE A 90 ? O ILE A 125 N LEU A 39 ? N LEU A 74 A 3 4 N ILE A 42 ? N ILE A 77 O ILE A 69 ? O ILE A 104 # _atom_sites.entry_id 2LBX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 36 36 SER SER A . n A 1 2 LYS 2 37 37 LYS LYS A . n A 1 3 LYS 3 38 38 LYS LYS A . n A 1 4 LEU 4 39 39 LEU LEU A . n A 1 5 ASN 5 40 40 ASN ASN A . n A 1 6 LYS 6 41 41 LYS LYS A . n A 1 7 LYS 7 42 42 LYS LYS A . n A 1 8 VAL 8 43 43 VAL VAL A . n A 1 9 LEU 9 44 44 LEU LEU A . n A 1 10 LYS 10 45 45 LYS LYS A . n A 1 11 THR 11 46 46 THR THR A . n A 1 12 VAL 12 47 47 VAL VAL A . n A 1 13 LYS 13 48 48 LYS LYS A . n A 1 14 LYS 14 49 49 LYS LYS A . n A 1 15 ALA 15 50 50 ALA ALA A . n A 1 16 SER 16 51 51 SER SER A . n A 1 17 LYS 17 52 52 LYS LYS A . n A 1 18 ALA 18 53 53 ALA ALA A . n A 1 19 LYS 19 54 54 LYS LYS A . n A 1 20 ASN 20 55 55 ASN ASN A . n A 1 21 VAL 21 56 56 VAL VAL A . n A 1 22 LYS 22 57 57 LYS LYS A . n A 1 23 ARG 23 58 58 ARG ARG A . n A 1 24 GLY 24 59 59 GLY GLY A . n A 1 25 VAL 25 60 60 VAL VAL A . n A 1 26 LYS 26 61 61 LYS LYS A . n A 1 27 GLU 27 62 62 GLU GLU A . n A 1 28 VAL 28 63 63 VAL VAL A . n A 1 29 VAL 29 64 64 VAL VAL A . n A 1 30 LYS 30 65 65 LYS LYS A . n A 1 31 ALA 31 66 66 ALA ALA A . n A 1 32 LEU 32 67 67 LEU LEU A . n A 1 33 ARG 33 68 68 ARG ARG A . n A 1 34 LYS 34 69 69 LYS LYS A . n A 1 35 GLY 35 70 70 GLY GLY A . n A 1 36 GLU 36 71 71 GLU GLU A . n A 1 37 LYS 37 72 72 LYS LYS A . n A 1 38 GLY 38 73 73 GLY GLY A . n A 1 39 LEU 39 74 74 LEU LEU A . n A 1 40 VAL 40 75 75 VAL VAL A . n A 1 41 VAL 41 76 76 VAL VAL A . n A 1 42 ILE 42 77 77 ILE ILE A . n A 1 43 ALA 43 78 78 ALA ALA A . n A 1 44 GLY 44 79 79 GLY GLY A . n A 1 45 ASP 45 80 80 ASP ASP A . n A 1 46 ILE 46 81 81 ILE ILE A . n A 1 47 SER 47 82 82 SER SER A . n A 1 48 PRO 48 83 83 PRO PRO A . n A 1 49 ALA 49 84 84 ALA ALA A . n A 1 50 ASP 50 85 85 ASP ASP A . n A 1 51 VAL 51 86 86 VAL VAL A . n A 1 52 ILE 52 87 87 ILE ILE A . n A 1 53 SER 53 88 88 SER SER A . n A 1 54 HIS 54 89 89 HIS HIS A . n A 1 55 ILE 55 90 90 ILE ILE A . n A 1 56 PRO 56 91 91 PRO PRO A . n A 1 57 VAL 57 92 92 VAL VAL A . n A 1 58 LEU 58 93 93 LEU LEU A . n A 1 59 CYS 59 94 94 CYS CYS A . n A 1 60 GLU 60 95 95 GLU GLU A . n A 1 61 ASP 61 96 96 ASP ASP A . n A 1 62 HIS 62 97 97 HIS HIS A . n A 1 63 SER 63 98 98 SER SER A . n A 1 64 VAL 64 99 99 VAL VAL A . n A 1 65 PRO 65 100 100 PRO PRO A . n A 1 66 TYR 66 101 101 TYR TYR A . n A 1 67 ILE 67 102 102 ILE ILE A . n A 1 68 PHE 68 103 103 PHE PHE A . n A 1 69 ILE 69 104 104 ILE ILE A . n A 1 70 PRO 70 105 105 PRO PRO A . n A 1 71 SER 71 106 106 SER SER A . n A 1 72 LYS 72 107 107 LYS LYS A . n A 1 73 GLN 73 108 108 GLN GLN A . n A 1 74 ASP 74 109 109 ASP ASP A . n A 1 75 LEU 75 110 110 LEU LEU A . n A 1 76 GLY 76 111 111 GLY GLY A . n A 1 77 ALA 77 112 112 ALA ALA A . n A 1 78 ALA 78 113 113 ALA ALA A . n A 1 79 GLY 79 114 114 GLY GLY A . n A 1 80 ALA 80 115 115 ALA ALA A . n A 1 81 THR 81 116 116 THR THR A . n A 1 82 LYS 82 117 117 LYS LYS A . n A 1 83 ARG 83 118 118 ARG ARG A . n A 1 84 PRO 84 119 119 PRO PRO A . n A 1 85 THR 85 120 120 THR THR A . n A 1 86 SER 86 121 121 SER SER A . n A 1 87 VAL 87 122 122 VAL VAL A . n A 1 88 VAL 88 123 123 VAL VAL A . n A 1 89 PHE 89 124 124 PHE PHE A . n A 1 90 ILE 90 125 125 ILE ILE A . n A 1 91 VAL 91 126 126 VAL VAL A . n A 1 92 PRO 92 127 127 PRO PRO A . n A 1 93 GLY 93 128 128 GLY GLY A . n A 1 94 SER 94 129 129 SER SER A . n A 1 95 ASN 95 130 130 ASN ASN A . n A 1 96 LYS 96 131 131 LYS LYS A . n A 1 97 LYS 97 132 132 LYS LYS A . n A 1 98 LYS 98 133 133 LYS LYS A . n A 1 99 ASP 99 134 134 ASP ASP A . n A 1 100 GLY 100 135 135 GLY GLY A . n A 1 101 LYS 101 136 136 LYS LYS A . n A 1 102 ASN 102 137 137 ASN ASN A . n A 1 103 LYS 103 138 138 LYS LYS A . n A 1 104 GLU 104 139 139 GLU GLU A . n A 1 105 GLU 105 140 140 GLU GLU A . n A 1 106 GLU 106 141 141 GLU GLU A . n A 1 107 TYR 107 142 142 TYR TYR A . n A 1 108 LYS 108 143 143 LYS LYS A . n A 1 109 GLU 109 144 144 GLU GLU A . n A 1 110 SER 110 145 145 SER SER A . n A 1 111 PHE 111 146 146 PHE PHE A . n A 1 112 ASN 112 147 147 ASN ASN A . n A 1 113 GLU 113 148 148 GLU GLU A . n A 1 114 VAL 114 149 149 VAL VAL A . n A 1 115 VAL 115 150 150 VAL VAL A . n A 1 116 LYS 116 151 151 LYS LYS A . n A 1 117 GLU 117 152 152 GLU GLU A . n A 1 118 VAL 118 153 153 VAL VAL A . n A 1 119 GLN 119 154 154 GLN GLN A . n A 1 120 ALA 120 155 155 ALA ALA A . n A 1 121 LEU 121 156 156 LEU LEU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-06 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2011-08-31 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.74 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.16 _pdbx_nmr_ensemble_rms.entry_id 2LBX _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HEPES-1 20 ? mM '[U-13C; U-15N]' 1 'potassium chloride-2' 200 ? mM '[U-13C; U-15N]' 1 DTT-3 1 ? mM '[U-13C; U-15N]' 1 HEPES-4 20 ? mM '[U-15N]' 2 'potassium chloride-5' 200 ? mM '[U-15N]' 2 DTT-6 1 ? mM '[U-15N]' 2 HEPES-7 20 ? mM '[U-13C; U-15N]' 3 'potassium chloride-8' 200 ? mM '[U-13C; U-15N]' 3 DTT-9 1 ? mM '[U-13C; U-15N]' 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LBX _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 915 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count 208 _pdbx_nmr_constraints.NOE_medium_range_total_count 140 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 567 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 89 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 88 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 82 ? ? -157.40 85.34 2 1 PRO A 83 ? ? -69.76 -177.84 3 1 SER A 98 ? ? 73.29 61.22 4 1 PRO A 100 ? ? -69.80 88.89 5 1 PRO A 105 ? ? -69.69 76.89 6 1 SER A 106 ? ? -166.77 101.52 7 1 ALA A 115 ? ? -177.96 104.36 8 1 PRO A 127 ? ? -69.76 78.90 9 1 GLU A 140 ? ? -57.43 -77.00 10 2 PRO A 83 ? ? -69.75 -176.08 11 2 SER A 98 ? ? 72.90 97.23 12 2 PRO A 100 ? ? -69.79 88.42 13 2 PRO A 105 ? ? -69.79 76.73 14 2 SER A 106 ? ? -163.40 102.28 15 2 ALA A 115 ? ? -171.45 107.08 16 2 LYS A 136 ? ? -64.67 92.46 17 2 GLU A 140 ? ? -57.73 -76.11 18 3 PRO A 83 ? ? -69.69 -176.86 19 3 SER A 98 ? ? 71.95 98.84 20 3 PRO A 100 ? ? -69.76 88.83 21 3 PRO A 105 ? ? -69.75 76.81 22 3 SER A 106 ? ? -168.64 102.07 23 3 ALA A 115 ? ? -168.65 105.33 24 3 SER A 121 ? ? -168.09 -38.76 25 3 SER A 129 ? ? -112.63 -169.69 26 3 GLU A 140 ? ? -55.88 -75.03 27 3 TYR A 142 ? ? -56.44 -70.91 28 4 SER A 82 ? ? -164.16 92.30 29 4 SER A 98 ? ? 73.69 62.26 30 4 PRO A 100 ? ? -69.74 89.49 31 4 PRO A 105 ? ? -69.73 72.29 32 4 ALA A 115 ? ? 178.75 118.13 33 4 ARG A 118 ? ? -180.00 81.12 34 4 LYS A 136 ? ? -60.29 -170.30 35 4 GLU A 140 ? ? -55.39 -75.18 36 4 TYR A 142 ? ? -59.69 -71.96 37 5 SER A 82 ? ? -170.61 147.94 38 5 SER A 98 ? ? 71.57 82.00 39 5 PRO A 100 ? ? -69.72 87.98 40 5 PRO A 105 ? ? -69.78 77.67 41 5 SER A 106 ? ? -164.91 105.15 42 5 ALA A 115 ? ? 177.24 115.33 43 5 ARG A 118 ? ? -155.36 76.67 44 5 SER A 129 ? ? -174.50 -174.41 45 5 ASN A 137 ? ? -148.72 -42.00 46 5 LYS A 138 ? ? -145.91 -51.03 47 5 GLU A 140 ? ? -56.77 -79.33 48 6 SER A 82 ? ? -171.15 148.59 49 6 PRO A 83 ? ? -69.78 -177.37 50 6 SER A 98 ? ? 72.29 69.18 51 6 PRO A 100 ? ? -69.83 88.95 52 6 PRO A 105 ? ? -69.77 70.02 53 6 ALA A 115 ? ? -179.54 114.11 54 6 SER A 129 ? ? -175.19 -174.46 55 6 GLU A 140 ? ? -58.12 -76.88 56 7 SER A 98 ? ? 71.80 74.62 57 7 PRO A 100 ? ? -69.77 88.44 58 7 PRO A 105 ? ? -69.79 77.86 59 7 SER A 106 ? ? -162.76 101.19 60 7 ALA A 115 ? ? -164.93 107.40 61 7 LYS A 136 ? ? -99.96 -65.17 62 7 ASN A 137 ? ? -61.27 -169.46 63 7 GLU A 140 ? ? -58.74 -75.76 64 8 PRO A 83 ? ? -69.79 -179.59 65 8 SER A 98 ? ? 72.38 96.27 66 8 PRO A 100 ? ? -69.75 88.26 67 8 PRO A 105 ? ? -69.84 78.18 68 8 SER A 106 ? ? -166.40 90.41 69 8 ALA A 115 ? ? -167.64 108.99 70 8 GLU A 140 ? ? -57.84 -76.71 71 9 LYS A 54 ? ? 63.77 61.39 72 9 SER A 82 ? ? -154.59 85.81 73 9 PRO A 83 ? ? -69.74 -173.49 74 9 SER A 98 ? ? 73.81 50.44 75 9 PRO A 100 ? ? -69.73 89.79 76 9 PRO A 105 ? ? -69.72 77.74 77 9 SER A 106 ? ? -167.93 93.58 78 9 ALA A 115 ? ? 79.72 114.13 79 9 ARG A 118 ? ? -168.78 68.28 80 9 ASN A 137 ? ? -129.31 -51.04 81 9 GLU A 140 ? ? -51.86 -77.11 82 10 SER A 82 ? ? -170.96 139.53 83 10 PRO A 83 ? ? -69.78 -173.81 84 10 SER A 98 ? ? 71.23 84.72 85 10 PRO A 100 ? ? -69.74 89.57 86 10 PRO A 105 ? ? -69.84 75.46 87 10 SER A 106 ? ? -161.94 113.68 88 10 ALA A 115 ? ? 178.79 116.25 89 10 ARG A 118 ? ? -176.85 74.95 90 10 SER A 129 ? ? -103.34 -64.60 91 10 ASN A 137 ? ? -148.39 -65.31 92 10 GLU A 140 ? ? -57.31 -76.69 93 11 ILE A 81 ? ? -136.23 -50.33 94 11 PRO A 83 ? ? -69.73 -167.60 95 11 SER A 98 ? ? 70.72 92.10 96 11 PRO A 100 ? ? -69.70 89.70 97 11 PRO A 105 ? ? -69.75 75.12 98 11 SER A 106 ? ? -170.37 96.07 99 11 ALA A 115 ? ? -167.04 106.98 100 11 LYS A 136 ? ? -131.38 -64.15 101 11 GLU A 140 ? ? -54.22 -75.98 102 11 TYR A 142 ? ? -57.50 -71.43 103 12 SER A 98 ? ? 70.57 90.71 104 12 PRO A 100 ? ? -69.74 89.41 105 12 PRO A 105 ? ? -69.75 76.18 106 12 SER A 106 ? ? -172.30 91.68 107 12 ALA A 115 ? ? -139.04 -33.39 108 12 LYS A 117 ? ? -132.25 -39.17 109 12 SER A 121 ? ? -145.37 -40.86 110 12 SER A 129 ? ? -175.12 -168.76 111 12 ASN A 137 ? ? -158.46 -62.10 112 12 LYS A 138 ? ? -95.34 33.82 113 12 GLU A 140 ? ? -59.41 -76.19 114 12 TYR A 142 ? ? -58.24 -71.17 115 13 LYS A 54 ? ? 64.19 60.55 116 13 PRO A 83 ? ? -69.76 -177.98 117 13 SER A 98 ? ? 73.26 81.83 118 13 PRO A 100 ? ? -69.77 88.45 119 13 PRO A 105 ? ? -69.73 78.19 120 13 SER A 106 ? ? -165.73 99.15 121 13 ALA A 115 ? ? -178.88 101.93 122 13 LYS A 117 ? ? -52.75 -75.29 123 13 ASN A 137 ? ? -100.48 55.92 124 13 LYS A 138 ? ? 39.81 38.69 125 14 PRO A 83 ? ? -69.76 -170.89 126 14 SER A 98 ? ? 73.55 58.01 127 14 PRO A 100 ? ? -69.73 88.98 128 14 PRO A 105 ? ? -69.77 65.06 129 14 ALA A 115 ? ? -175.35 100.81 130 14 PRO A 127 ? ? -69.82 96.58 131 14 SER A 129 ? ? -51.52 105.53 132 14 LYS A 136 ? ? -103.47 -75.17 133 14 LYS A 138 ? ? -57.26 -75.71 134 14 GLU A 140 ? ? -59.55 -75.90 135 15 PRO A 83 ? ? -69.70 -176.80 136 15 PRO A 100 ? ? -69.74 88.57 137 15 PRO A 105 ? ? -69.78 77.01 138 15 SER A 106 ? ? -172.96 92.35 139 15 ALA A 115 ? ? -175.12 107.27 140 15 PRO A 119 ? ? -69.78 -170.83 141 15 LYS A 138 ? ? 39.91 36.43 142 15 GLU A 139 ? ? -52.19 -77.64 143 16 PRO A 83 ? ? -69.80 -170.14 144 16 SER A 98 ? ? 74.77 72.12 145 16 PRO A 100 ? ? -69.70 88.00 146 16 PRO A 105 ? ? -69.75 78.16 147 16 SER A 106 ? ? -171.09 96.53 148 16 ALA A 115 ? ? -177.56 113.80 149 16 ARG A 118 ? ? 63.82 74.84 150 16 PRO A 119 ? ? -69.78 -178.65 151 16 SER A 129 ? ? -59.03 103.41 152 16 LYS A 136 ? ? -60.90 96.25 153 16 GLU A 140 ? ? -55.48 -77.98 154 17 SER A 82 ? ? -151.31 85.24 155 17 PRO A 83 ? ? -69.82 -176.54 156 17 SER A 98 ? ? 73.24 51.86 157 17 PRO A 100 ? ? -69.76 89.08 158 17 PRO A 105 ? ? -69.77 77.88 159 17 SER A 106 ? ? -163.23 92.41 160 17 ALA A 115 ? ? -175.03 111.09 161 17 THR A 116 ? ? -49.02 154.98 162 17 ARG A 118 ? ? -160.89 74.19 163 17 GLU A 140 ? ? -63.31 -75.21 164 18 PRO A 83 ? ? -69.75 -172.09 165 18 SER A 98 ? ? 47.19 85.36 166 18 PRO A 100 ? ? -69.74 89.24 167 18 PRO A 105 ? ? -69.73 79.41 168 18 ALA A 115 ? ? -171.98 102.08 169 18 ARG A 118 ? ? -174.65 67.50 170 18 VAL A 122 ? ? -160.62 116.69 171 18 PRO A 127 ? ? -69.76 77.25 172 18 GLU A 140 ? ? -57.42 -76.46 173 19 PRO A 83 ? ? -69.73 -175.09 174 19 SER A 98 ? ? 73.34 73.05 175 19 PRO A 100 ? ? -69.78 87.82 176 19 PRO A 105 ? ? -69.78 64.19 177 19 ALA A 115 ? ? -173.87 105.16 178 19 LYS A 136 ? ? -89.05 -75.14 179 19 GLU A 140 ? ? -57.58 -76.41 180 19 TYR A 142 ? ? -58.47 -72.49 181 20 PRO A 83 ? ? -69.75 -179.14 182 20 SER A 98 ? ? 71.65 93.64 183 20 PRO A 100 ? ? -69.80 88.76 184 20 PRO A 105 ? ? -69.73 74.13 185 20 SER A 106 ? ? -162.25 101.82 186 20 ALA A 115 ? ? -171.55 117.20 187 20 ARG A 118 ? ? 62.91 77.38 188 20 PRO A 127 ? ? -69.72 77.32 189 20 GLU A 140 ? ? -53.58 -77.55 190 20 TYR A 142 ? ? -67.02 -71.32 #