data_2LC0 # _entry.id 2LC0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2LC0 pdb_00002lc0 10.2210/pdb2lc0/pdb RCSB RCSB102210 ? ? WWPDB D_1000102210 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 17585 BMRB unspecified . 2LC1 PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2LC0 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2011-04-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Barthe, P.P.' 1 'Cohen-Gonsaud, M.M.' 2 'Roumestand, C.' 3 # _citation.id primary _citation.title 'Structural Insight into the Mycobacterium tuberculosis Rv0020c Protein and Its Interaction with the PknB Kinase' _citation.journal_abbrev Structure _citation.journal_volume 19 _citation.page_first 1525 _citation.page_last 1534 _citation.year 2011 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22000520 _citation.pdbx_database_id_DOI 10.1016/j.str.2011.07.011 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Roumestand, C.' 1 ? primary 'Leiba, J.' 2 ? primary 'Galophe, N.' 3 ? primary 'Margeat, E.' 4 ? primary 'Padilla, A.' 5 ? primary 'Bessin, Y.' 6 ? primary 'Barthe, P.' 7 ? primary 'Molle, V.' 8 ? primary 'Cohen-Gonsaud, M.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative uncharacterized protein TB39.8' _entity.formula_weight 14773.442 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-132' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAADGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPEL KSTGFARDLADYIQEQGWQTYGDVVVRFEQSSNLHTGQFRARGTVNPDVETH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAADGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPEL KSTGFARDLADYIQEQGWQTYGDVVVRFEQSSNLHTGQFRARGTVNPDVETH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 GLN n 1 5 LYS n 1 6 ARG n 1 7 LEU n 1 8 VAL n 1 9 GLN n 1 10 ARG n 1 11 VAL n 1 12 GLU n 1 13 ARG n 1 14 LYS n 1 15 LEU n 1 16 GLU n 1 17 GLN n 1 18 THR n 1 19 VAL n 1 20 GLY n 1 21 ASP n 1 22 ALA n 1 23 PHE n 1 24 ALA n 1 25 ARG n 1 26 ILE n 1 27 PHE n 1 28 GLY n 1 29 GLY n 1 30 SER n 1 31 ILE n 1 32 VAL n 1 33 PRO n 1 34 GLN n 1 35 GLU n 1 36 VAL n 1 37 GLU n 1 38 ALA n 1 39 LEU n 1 40 LEU n 1 41 ARG n 1 42 ARG n 1 43 GLU n 1 44 ALA n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 ILE n 1 49 GLN n 1 50 SER n 1 51 LEU n 1 52 GLN n 1 53 GLY n 1 54 ASN n 1 55 ARG n 1 56 LEU n 1 57 LEU n 1 58 ALA n 1 59 PRO n 1 60 ASN n 1 61 GLU n 1 62 TYR n 1 63 ILE n 1 64 ILE n 1 65 THR n 1 66 LEU n 1 67 GLY n 1 68 VAL n 1 69 HIS n 1 70 ASP n 1 71 PHE n 1 72 GLU n 1 73 LYS n 1 74 LEU n 1 75 GLY n 1 76 ALA n 1 77 ASP n 1 78 PRO n 1 79 GLU n 1 80 LEU n 1 81 LYS n 1 82 SER n 1 83 THR n 1 84 GLY n 1 85 PHE n 1 86 ALA n 1 87 ARG n 1 88 ASP n 1 89 LEU n 1 90 ALA n 1 91 ASP n 1 92 TYR n 1 93 ILE n 1 94 GLN n 1 95 GLU n 1 96 GLN n 1 97 GLY n 1 98 TRP n 1 99 GLN n 1 100 THR n 1 101 TYR n 1 102 GLY n 1 103 ASP n 1 104 VAL n 1 105 VAL n 1 106 VAL n 1 107 ARG n 1 108 PHE n 1 109 GLU n 1 110 GLN n 1 111 SER n 1 112 SER n 1 113 ASN n 1 114 LEU n 1 115 HIS n 1 116 THR n 1 117 GLY n 1 118 GLN n 1 119 PHE n 1 120 ARG n 1 121 ALA n 1 122 ARG n 1 123 GLY n 1 124 THR n 1 125 VAL n 1 126 ASN n 1 127 PRO n 1 128 ASP n 1 129 VAL n 1 130 GLU n 1 131 THR n 1 132 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Rv0020c, TB39.8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain H37rv _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83332 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET15b-tev _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code P71590_MYCTU _struct_ref.pdbx_db_accession P71590 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAADGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPEL KSTGFARDLADYIQEQGWQTYGDVVVRFEQSSNLHTGQFRARGTVNPDVETH ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2LC0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P71590 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 132 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 132 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-15N TOCSY' 1 3 2 '3D HNCA' 1 4 2 '3D CBCA(CO)NH' 1 5 2 '3D HNCACB' 1 6 2 '3D HNCO' 1 7 2 '3D HCACO' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-15N] Rv0020c_Nter-1, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.5 mM [U-13C; U-15N] Rv0020c_Nter-2, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 500 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2LC0 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Water refinement with RECOORD scripts' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2LC0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2LC0 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version Delsuc processing Gifa 1 4.44 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2 2.1 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 3 1.2 'Cornilescu, Delaglio and Bax' 'angle prediction' TALOS+ 4 1.2009.0721.18 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2LC0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2LC0 _struct.title 'Rv0020c_Nter structure' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2LC0 _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text 'FhaA, KINASE SUBSTRATE, PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 21 ? GLY A 28 ? ASP A 21 GLY A 28 1 ? 8 HELX_P HELX_P2 2 PRO A 33 ? GLY A 47 ? PRO A 33 GLY A 47 1 ? 15 HELX_P HELX_P3 3 VAL A 68 ? GLY A 75 ? VAL A 68 GLY A 75 1 ? 8 HELX_P HELX_P4 4 PRO A 78 ? GLY A 97 ? PRO A 78 GLY A 97 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 105 ? SER A 111 ? VAL A 105 SER A 111 A 2 GLU A 61 ? GLY A 67 ? GLU A 61 GLY A 67 A 3 PHE A 119 ? THR A 124 ? PHE A 119 THR A 124 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 107 ? O ARG A 107 N TYR A 62 ? N TYR A 62 A 2 3 N THR A 65 ? N THR A 65 O ARG A 120 ? O ARG A 120 # _atom_sites.entry_id 2LC0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASP 88 88 88 ASP ASP A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 TRP 98 98 98 TRP TRP A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 SER 112 112 112 SER SER A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 GLN 118 118 118 GLN GLN A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ARG 122 122 122 ARG ARG A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 HIS 132 132 132 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-11-02 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Rv0020c_Nter-1 0.5 ? mM '[U-15N]' 1 Rv0020c_Nter-2 0.5 ? mM '[U-13C; U-15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2LC0 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 92 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1497 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 458 _pdbx_nmr_constraints.NOE_long_range_total_count 347 _pdbx_nmr_constraints.NOE_medium_range_total_count 209 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 483 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 93 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 93 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HZ1 A LYS 5 ? ? OE1 A GLU 109 ? ? 1.60 2 23 HG1 A THR 18 ? ? OD1 A ASP 88 ? ? 1.59 3 27 OE1 A GLU 37 ? ? HH21 A ARG 41 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 9 ? ? -67.39 93.66 2 1 LEU A 51 ? ? -122.56 -164.78 3 2 SER A 30 ? ? -103.14 -150.00 4 3 ARG A 13 ? ? -89.88 -92.67 5 3 LYS A 14 ? ? -178.53 141.12 6 4 LEU A 15 ? ? -93.71 -76.49 7 4 LEU A 51 ? ? -102.38 -165.48 8 4 ARG A 55 ? ? -172.97 149.87 9 5 PRO A 33 ? ? -67.14 95.74 10 5 LEU A 51 ? ? -101.91 -165.38 11 5 GLU A 130 ? ? -49.71 98.85 12 6 GLU A 12 ? ? 59.87 76.77 13 6 GLN A 34 ? ? -143.02 25.48 14 6 PHE A 119 ? ? -176.11 147.70 15 6 ASP A 128 ? ? -102.17 69.43 16 7 ASP A 77 ? ? -160.35 68.34 17 7 VAL A 129 ? ? -64.16 98.82 18 8 LEU A 51 ? ? -119.62 -165.83 19 8 ASP A 128 ? ? -101.07 77.26 20 9 GLN A 4 ? ? -78.04 24.85 21 9 VAL A 8 ? ? -93.73 -79.89 22 9 LYS A 14 ? ? -171.42 140.21 23 9 PRO A 33 ? ? -64.46 87.57 24 10 GLU A 16 ? ? -178.57 94.69 25 10 LEU A 51 ? ? -116.24 -164.40 26 10 GLN A 52 ? ? -48.30 154.89 27 10 ASP A 77 ? ? -155.71 83.74 28 11 PRO A 33 ? ? -70.56 30.55 29 11 LEU A 51 ? ? -104.40 -165.77 30 11 ARG A 55 ? ? 177.35 166.09 31 12 ARG A 10 ? ? -118.83 78.93 32 12 LEU A 15 ? ? -117.09 77.34 33 12 ASN A 60 ? ? -131.36 -32.71 34 13 GLN A 9 ? ? -174.73 104.13 35 13 ARG A 10 ? ? -139.58 -159.74 36 13 LEU A 51 ? ? -118.12 -166.34 37 14 ARG A 55 ? ? -171.59 147.90 38 15 SER A 30 ? ? -69.46 -74.44 39 15 LEU A 51 ? ? -104.24 -165.97 40 15 THR A 116 ? ? -35.83 124.64 41 16 LEU A 51 ? ? -118.67 -163.92 42 16 ASP A 128 ? ? -97.23 42.58 43 17 SER A 3 ? ? 62.08 73.99 44 17 GLU A 12 ? ? -117.93 -166.00 45 18 LYS A 5 ? ? -114.10 -162.19 46 19 GLN A 4 ? ? 61.81 -0.74 47 19 LEU A 51 ? ? -127.02 -165.59 48 20 THR A 18 ? ? -56.30 107.26 49 22 LEU A 7 ? ? 61.56 72.32 50 22 LEU A 51 ? ? -103.08 -165.41 51 22 ASP A 128 ? ? -100.28 70.58 52 23 ARG A 6 ? ? 177.44 171.10 53 23 VAL A 11 ? ? -59.73 109.54 54 23 VAL A 19 ? ? 172.15 169.90 55 23 SER A 30 ? ? -80.32 -86.13 56 23 ASN A 60 ? ? -132.81 -33.45 57 23 ASP A 128 ? ? -91.24 32.08 58 24 THR A 18 ? ? -178.37 145.07 59 24 LEU A 51 ? ? -112.65 -164.21 60 24 GLN A 52 ? ? -49.67 156.99 61 24 ASP A 128 ? ? -91.34 33.14 62 25 GLN A 4 ? ? 67.93 -43.54 63 25 LYS A 14 ? ? -91.96 -69.75 64 25 GLU A 130 ? ? -69.47 95.00 65 27 VAL A 11 ? ? -112.40 73.02 66 27 GLU A 12 ? ? -86.41 30.40 67 27 LEU A 15 ? ? -152.07 -66.68 68 27 ALA A 76 ? ? -61.53 6.93 69 27 ASP A 77 ? ? -43.45 106.85 70 28 GLN A 34 ? ? 176.46 -41.67 71 28 THR A 116 ? ? -36.02 112.87 72 29 VAL A 8 ? ? 65.44 91.19 73 29 ARG A 13 ? ? -119.66 79.15 74 29 LEU A 51 ? ? -105.20 -165.96 75 30 SER A 30 ? ? 51.78 75.39 76 30 PRO A 33 ? ? -65.65 29.21 77 30 LEU A 51 ? ? -109.16 -164.69 78 30 THR A 131 ? ? -30.41 115.51 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 5 ARG A 13 ? ? 0.081 'SIDE CHAIN' 2 8 ARG A 13 ? ? 0.076 'SIDE CHAIN' 3 8 ARG A 42 ? ? 0.091 'SIDE CHAIN' 4 11 ARG A 55 ? ? 0.078 'SIDE CHAIN' 5 11 ARG A 107 ? ? 0.073 'SIDE CHAIN' 6 24 ARG A 107 ? ? 0.114 'SIDE CHAIN' #